KEGG   Synechococcus sp. PCC 7502: Syn7502_02895Help
Entry
Syn7502_02895     CDS       T02371                                 

Definition
(GenBank) nucleoside-diphosphate-sugar epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
synp00520  Amino sugar and nucleotide sugar metabolism
synp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:synp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Syn7502_02895
Enzymes [BR:synp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Syn7502_02895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: AFY74823
UniProt: K9SXB2
Position
2842256..2843197
Genome map
AA seq 313 aa AA seqDB search
MRILVTGGAGFIGSHLCDRLIEAGNEVICLDNFYTGHKRNIQHLLEHPRFELIRHDITEP
ITLEVDQIYHLACPASPVHYQSNAIKTIKTNVIGTMNMLGLAKRLKARFLLASTSEVYGD
PEIHPQSEDYWGNVNPIGIRSCYDEGKRISETLAFDYHRQNAVDIRVARIFNTHGARMLE
NDGRVVSNFVVQALKGIPLTVYGDGSQTRSFCYVSDLVEGLIRLMNGTYIGPVNLGNPGE
YTILQLASTIQRMVNPDVDIVFKPLPQDDPRRRQPDISKAKHWLDWEPKVQLEEGLAMTI
AYFREFLRNTQAQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcggattttagttactggtggtgctggctttattggttctcatctttgcgatcgcctg
attgaagcaggaaatgaagttatttgtttagataatttctacacaggacataagcgcaat
attcaacatctacttgagcatcctcgatttgagttgattcgccatgatattactgaacca
atcaccttagaagtcgatcaaatttaccaccttgcctgtccagcctctcctgtgcattac
caatccaatgcgatcaaaaccattaaaaccaatgtcatcggtactatgaatatgctaggg
ctggcaaaacgactaaaggcaagatttttattggcatctacctctgaagtttacggtgat
cctgaaattcatcctcaatcggaagactattgggggaatgttaatcccatcggtattcgt
agctgctacgacgaaggtaagcgtatatctgaaaccctagcctttgattatcatcgccaa
aatgcagttgatattcgagttgcccgtatattcaatacccacggtgccagaatgctagaa
aatgatgggcgggttgtcagtaattttgtggtgcaggcattaaagggtattcccctaacg
gtgtatggtgatggttctcaaactcgcagtttttgctatgtttccgatttggttgaaggt
ttgatccgcctgatgaatggcacttacattggacctgtaaatttggggaatccgggagag
tatacaattttacaattggcatcgacaattcagcgtatggttaaccccgatgtcgatatt
gtatttaagcctttgccccaagatgatccccgtcgccgtcaacctgatatttctaaagct
aagcattggttagattgggagcctaaggtgcagttagaagagggactagcgatgacgatc
gcttactttagggaatttttaagaaatactcaagctcaatag

DBGET integrated database retrieval system