KEGG   Synechocystis sp. IPPAS B-1465: C7I86_05985Help
Entry
C7I86_05985       CDS       T05368                                 

Definition
(GenBank) KR domain-containing protein
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
syo  Synechocystis sp. IPPAS B-1465
Pathway
syo00030  Pentose phosphate pathway
syo01100  Metabolic pathways
syo01120  Microbial metabolism in diverse environments
syo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C7I86_05985
Enzymes [BR:syo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     C7I86_05985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_7 THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AVP89270
Position
complement(1275053..1275799)
Genome map
AA seq 248 aa AA seqDB search
MELTGKTALVTGGGIRVGRALVMALAEAGCNVFIHYGNSQTGALEVQQEVEALGRKAFTY
SADLSDAQATQGIIPKAQEVFGQVDILINSASVFPLEDKFFQVDLDLWEWIFAVNLRAPF
QLSQAFAQQVAGDRQGKIININDARIPRPRPDHFVYRLTKRGLWDMTEILALELAPNITV
NGLALGQILEAPEAPDPEEFMRDYAERRIPLKMTGNPKVVTDAALYLLQQDFLSGTTIRL
DGAEYLKF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggaattaactggaaaaacagccctggtcaccgggggaggcataagggttggtcgggcc
ctagttatggccctggcggaagccggttgtaacgtctttattcactacggtaattcccag
accggagccctagaggttcagcaagaagtggaagcattgggtaggaaagcttttacctac
tccgccgatttgagcgatgcccaggccacccaaggaattattcccaaagcccaggaagtc
tttggccaggtggatattctgatcaacagtgcctcggtttttcccctagaagataaattc
tttcaagtggatctcgacctgtgggaatggatttttgccgttaatctccgggcccccttt
cagttgtcccaggcctttgctcaacaagtagccggcgatcgccaaggaaaaattattaac
attaacgatgcccgcattccccgaccaaggccagaccattttgtttaccgtcttaccaaa
cggggtttgtgggatatgacggaaattttagccctggaattggcccccaatatcaccgtt
aatggcctcgccctaggacagattttagaagctccggaagcgccggacccggaagagttt
atgcgggattatgcagagcgacgtattcctttaaaaatgaccggcaatcccaaagtagtc
actgatgcggccctatatttgctacaacaggattttctgagtggcaccaccattcgttta
gatggagcagaatatttgaagttttag

DBGET integrated database retrieval system