KEGG   Synechocystis sp. IPPAS B-1465: C7I86_15675Help
Entry
C7I86_15675       CDS       T05368                                 

Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
syo  Synechocystis sp. IPPAS B-1465
Pathway
syo00310  Lysine degradation
syo01100  Metabolic pathways
syo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    C7I86_15675
Enzymes [BR:syo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     C7I86_15675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo NAD_binding_8 Thi4 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AVP90984
Position
complement(3366784..3367977)
Genome map
AA seq 397 aa AA seqDB search
MASYDITIIGGGIVGLATGLFIGRRFPQYKLLILEKEADPAHHQTGHNSGVIHSGIYYKP
GSFKAQFTKAGNQSMVEFCQEHALPYEVCGKVIVATKPEELPLLENLFNRGQANGLKVKK
LSAEQVKEYEPHVQCLGGIHVFTSGIVNYKLVCQKYAELIQVQGGEIKFNHRVNGIVTQA
NGHSLITNQGNFFSRFLINCGGLQSDRLAKMAGINPDAKIVPFRGEYYELKPEKRYLVKG
LIYPVPNPAFPFLGVHFTRMIDGSIHAGPNAVLSLKREGYRKTDFDWGDFTEVMAYAGFW
KLVGKHWQEGLQEVIRSFSKAAFVRSLQELIPEVTADDILPNPAGVRAQALKNDGALVED
FLIVPGPNSLQVLNAPSPAATASLEIGQAIAAQVPAL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctatgacatcacaattatcggcggtggcattgtcggtttggccacggggtta
tttattggtcgccgctttccccaatacaaattgttgattttagaaaaagaagcggaccca
gcccaccatcaaacggggcacaatagcggtgtcattcactctggtatttactacaaacct
ggcagctttaaggcccagttcactaaagctggtaaccagagcatggtggaattttgccaa
gagcacgccttaccctacgaggtttgtggcaaagtcattgtagctactaaacctgaggaa
ttaccgttattagaaaatttatttaaccggggtcaagccaatggcttaaaagttaaaaaa
cttagtgcagaacaagttaaggaatacgaaccccatgtgcaatgtttgggaggaattcat
gtattcacctctggcattgttaattacaaactggtttgtcaaaaatatgcggaactaatt
caggtccagggaggggaaattaagtttaaccatcgagtcaatggcattgttacccaggct
aacggacatagtttgatcactaaccaggggaatttttttagtcgttttctgatcaattgt
ggtggtctccagagcgatcgcctggccaaaatggcgggcattaaccccgatgctaaaatt
gtgccttttcggggagaatattatgagttgaagccagagaaaagatatttagtcaaaggt
ttaatttacccggtacctaatccggcttttccctttttaggggtgcatttcacccgcatg
attgatggcagtatccacgctggccccaatgcggtgctgagtttgaaacgggaaggttat
cgcaaaacggattttgattggggagattttaccgaagtgatggcctatgctggcttttgg
aagttggtgggtaaacattggcaagaaggcttacaggaagttattcgctcctttagtaag
gcggcctttgtgcggagtttacaggaattaattccggaagtgacagcggacgatattctt
cccaatccagcgggggtgagggcccaggctttgaaaaatgatggggctttggtggaggat
tttctgattgtccccggtcctaattctctccaggtgctcaatgctccttccccagcggcc
accgcttccttagaaattggccaggcgatcgccgcccaggtaccagcgctgtaa

DBGET integrated database retrieval system