KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0106Help
Entry
SYNPCC7002_A0106  CDS       T00664                                 

Gene name
gap
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00010  Glycolysis / Gluconeogenesis
syp00710  Carbon fixation in photosynthetic organisms
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
syp01120  Microbial metabolism in diverse environments
syp01130  Biosynthesis of antibiotics
syp01200  Carbon metabolism
syp01230  Biosynthesis of amino acids
Module
syp_M00002  Glycolysis, core module involving three-carbon compounds
syp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCC7002_A0106 (gap)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNPCC7002_A0106 (gap)
Enzymes [BR:syp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     SYNPCC7002_A0106 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: ACA98121
CyanoBase: SYNPCC7002_A0106
CYORF: SYNPCC7002_A0106
UniProt: B1XLG1
Position
107108..108124
Genome map
AA seq 338 aa AA seqDB search
MIRVAINGFGRIGRNFLRCWAGRENSQLQVVGINATTDTKSNAHMLRYDTMLGKFDGEID
YDANSLTVNGNVIKCCSDRNPLNLPWKEWGVDLVIESTGVFNTEEGSSKHITAGAQKVLI
TAPGKGGHIGTYVVGVNADQYGHDKQNVISNASCTTNCLAPIVKVLNDRFGIVKGTMTTV
HSYTGDQRILDNSHRDLRRARAAAENIVPTSTGAAKAVALVIPEMKGKLNGIAMRVPTPN
VSVVDLVAQVAKPTIAEEVNQVLKEASETYMKGILAYTEEPLVSCDFRGTDVSSTIDGSL
TLAMDGDLIKVVAWYDNEWGYSQRVVDLAEIVAQNWQG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagtagcgattaatggatttggacgtattggacgcaacttcttgagatgttgg
gctggtcgcgaaaacagccaactccaagtcgttgggatcaatgcgaccaccgataccaaa
agtaatgcccacatgcttcgttatgacacgatgctgggtaaatttgatggcgaaatcgat
tatgacgccaactctctgactgtcaacggcaacgtaatcaaatgctgttccgacagaaac
cccctcaacctcccttggaaagagtggggcgtcgatttggtgatcgaatctaccggtgta
ttcaacaccgaagaaggatcttctaagcacattacagctggtgcacaaaaagtattgatc
acagcccctggtaaaggcggccatatcggcacctatgtagttggtgtaaacgccgatcag
tatggccacgacaaacaaaatgtcatcagtaatgccagctgtaccaccaactgcctcgcc
cccattgttaaagtactcaatgatcgttttgggatcgtcaaagggacgatgaccaccgtc
cacagttacactggcgaccaacgtatcctcgacaacagccaccgggatctccgtcgggcg
cgggcagccgcagaaaatattgtgccgacttctactggcgcagctaaagccgttgcctta
gttattcccgaaatgaagggtaagctcaacgggatcgccatgcgggtaccgactcccaac
gtctccgtagttgacctggttgcccaagtagcgaagcccaccattgctgaggaagttaac
caagttctgaaagaagcttctgaaacctacatgaaagggattttggcttacaccgaagaa
cccctcgtctcctgtgacttccggggaactgatgtctcttccaccattgacggtagcctc
accctcgccatggacggtgacctaattaaagttgtggcttggtacgacaacgagtggggt
tattctcaacgggttgttgacctcgcagaaatcgttgcccaaaattggcaagggtaa

DBGET integrated database retrieval system