KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0162Help
Entry
SYNPCC7002_A0162  CDS       T00664                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00010  Glycolysis / Gluconeogenesis
syp00030  Pentose phosphate pathway
syp00051  Fructose and mannose metabolism
syp00052  Galactose metabolism
syp00680  Methane metabolism
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
syp01120  Microbial metabolism in diverse environments
syp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCC7002_A0162 (pfkA)
   00030 Pentose phosphate pathway
    SYNPCC7002_A0162 (pfkA)
   00051 Fructose and mannose metabolism
    SYNPCC7002_A0162 (pfkA)
   00052 Galactose metabolism
    SYNPCC7002_A0162 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SYNPCC7002_A0162 (pfkA)
Enzymes [BR:syp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SYNPCC7002_A0162 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SYNPCC7002_A0162 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACA98176
CyanoBase: SYNPCC7002_A0162
CYORF: SYNPCC7002_A0162
UniProt: B1XM29
Position
complement(167725..168822)
Genome map
AA seq 365 aa AA seqDB search
MGNVKKIGVLTSGGDCSGLNAAIRAVTRCARHQYGWEVIGICRATLGLLQEPPETIVLTE
DQVDTWLTMGGTMLGTTNKGNPFAFPMEDGSLKDRSQEIGEAYHRLGLDALVGIGGDGSL
AILQKLAHLGGMNLVGIPKTIDNDVGITERSIGFETAVNIATEALDRLHFTAASHNRVMI
VEVMGRDAGHIALNAGIAGGAHVILIPEIAYDLQTVCEFICDRQNSGNGHTLVVVSEAVC
TTSGETLKHELQFGECRLGGIGQYMGDEVAKKTGAETRVTVLGHIQRGGIASPLDRLLAS
AFGVAAVDLIAQGKFDHMVTWQNGQVSSAPISEAIEINRVVDPEGTLVKTARGLGICLGD
RPGEI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgtaaaaaaaattggtgtactcaccagtggcggcgactgctccggcttgaat
gcagcgattcgggctgtaactcgctgtgcccgacatcaatacggttgggaagtgattggt
atctgtcgagcgaccctcggcctgctccaggagccaccagaaaccattgtcctcaccgaa
gatcaagtcgatacttggttaacgatggggggcaccatgttagggacgaccaataaaggt
aatccctttgcttttcccatggaagacggttccctaaaggatcgatctcaagaaattggc
gaagcctatcaccgcttggggctggatgcactggtcgggattggtggcgatggtagcttg
gcgattctccagaaattagcccacctggggggcatgaacctcgtgggcatccccaaaacc
attgacaatgatgtgggcattacggaacgttccattgggtttgaaacagcggtcaatatt
gccacagaagctttagatcgactgcattttacggcggccagtcacaaccgagtgatgatt
gtggaagtcatggggcgcgatgctggccacatcgccttaaatgcgggtattgctggcggt
gcccatgtgatcttgatcccagagattgcctacgacttacagacggtgtgtgagtttatt
tgcgatcgccaaaattccggtaatggtcatacccttgtcgttgtttcagaggcggtctgt
accacctctggggaaaccctcaaacatgaattgcaatttggggaatgtcgcctggggggc
atcggtcaatacatgggcgatgaggtggccaaaaagactggcgcagaaacgcgggtaacg
gtattgggccacatccaacgggggggcatcgcctcacccctagaccgtttgttggcctcg
gcctttggggtggcggcggtggatttgattgcccagggcaaatttgatcacatggtgact
tggcaaaatggccaggtgtctagtgcgcccattagtgaggccattgagatcaatcgggtc
gttgatccggagggaactttggtgaaaaccgcgcggggcttagggatttgtcttggcgat
cgcccaggtgaaatttag

DBGET integrated database retrieval system