KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0330Help
Entry
SYNPCC7002_A0330  CDS       T00664                                 

Gene name
malQ
Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00500  Starch and sucrose metabolism
syp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SYNPCC7002_A0330 (malQ)
Enzymes [BR:syp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SYNPCC7002_A0330 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ACA98340
CyanoBase: SYNPCC7002_A0330
CYORF: SYNPCC7002_A0330
UniProt: B1XNG2
Position
344426..345799
Genome map
AA seq 457 aa AA seqDB search
MGPTGFGNSPYLCYSAFAGNPMLLNLEWLASEDLLEEADLAACPSCPRDRVDYDQAIAFK
MPLLRKACKRFQAVATPERKQEFQTFCEEQAYWLNDYALFMALKEAHDGKSWYDWDAALA
WRDPKAIAQQTEILADQVFFHKYAQSEFFRQWSTLKSYANEKGIQIFGDLPIYVAHDSAD
VWGHPKIFRLDYETGAAKWMAGVPPDYFSETGQLWGNPVYNWRNLSRRHYSWWIERIKTM
LEYVDIVRIDHFRGFEAFWAVPQGEKTAMNGRWIKAKGDEFFALLKDKLGELPIVAEDLG
VITPDVEALRDKYRLPGMKILHFAFDSDRANPFLPFNYTNRNCIVYTGTHDNDTTVGWFD
KRSDEEKARVTDYLGCLCDEGIHWGLIRLALGSVANLAVFPLQDLLGLGSEAKMNTPGVA
AGNWTWRYQPEMLSDDLIGKLRYLVYLYGREPEYRGE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
ctggggccaacggggtttgggaattctccttatctgtgttattcggcctttgcgggcaat
ccgatgctgttaaatttggagtggcttgcttcagaagatttattagaagaagctgatttg
gcggcctgtccgagttgtcctagagatcgagtggactatgatcaggcgatcgcctttaag
atgcccctcctgagaaaagcctgtaaacgcttccaggcggtggcgaccccagagagaaaa
caagaatttcaaaccttttgcgaagagcaggcctattggctcaatgattatgcactcttt
atggccctcaaggaagcccacgacggcaaaagctggtatgactgggatgctgcccttgct
tggcgtgacccaaaggcgatcgcccagcagacagagatcctcgccgatcaagtctttttc
cacaaatacgcccaatcagaatttttccgccagtggtcaaccctaaaaagctatgccaat
gaaaagggcatccaaatctttggggatttgccgatctatgtggcccacgacagtgccgat
gtgtggggccatccgaaaattttccgtctcgattatgaaaccggagctgccaagtggatg
gcgggagtcccaccggattatttcagcgaaacgggccaactctggggcaacccggtttac
aactggcgtaacctttcgcgccgtcactattcctggtggatcgagcgcattaaaaccatg
ctggagtatgtcgatattgttcgtatcgatcacttccggggttttgaagcgttttgggcg
gtgccccaaggggaaaaaacggcgatgaatggccgctggatcaaggctaagggtgacgaa
ttttttgcgttactcaaagataaactcggtgaattgcccatcgtcgctgaggatctgggg
gtaatcacgccggacgtggaggctctacgagataaatatcgcttgccaggtatgaagatt
ctgcactttgccttcgatagcgatcgcgccaatccgtttctaccgttcaactacaccaat
cgcaattgcattgtctacacaggcacccacgacaatgacaccacggtgggctggtttgac
aagcgcagtgacgaagaaaaggcgcgggtcacggattacctcggttgcctctgcgatgag
ggaattcattggggtctgatccgtctggcgttgggttccgtggcaaatctggcagttttc
cccctccaagatctacttggtttggggtctgaggcaaaaatgaatacccctggggtggcc
gccgggaactggacttggcgctaccagccggaaatgctgagtgatgacctcattggcaaa
ttacgctacctcgtctatctttacgggcgtgaaccggagtatcgaggcgaataa

DBGET integrated database retrieval system