KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1348Help
Entry
SYNPCC7002_A1348  CDS       T00664                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
syp01130  Biosynthesis of antibiotics
syp01230  Biosynthesis of amino acids
Module
syp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNPCC7002_A1348 (trpC)
Enzymes [BR:syp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SYNPCC7002_A1348 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG NanE
Motif
Other DBs
NCBI-ProteinID: ACA99344
CyanoBase: SYNPCC7002_A1348
CYORF: SYNPCC7002_A1348
UniProt: B1XLQ1
Position
1403069..1403959
Genome map
AA seq 296 aa AA seqDB search
MTVQIRRLHPSRPVNVSILQYQVAVPDAKPQHILEEIVWHKEKEVEQLRDKVSLLELRQR
VTTVPPAKDFLGALVHGKTQPALIAEVKKASPSKGVIREDFDPVAIAKSYAAGGASCLSV
LTDNKFFQGSFENLSLVRDAVDLPLLCKEFIIYPYQIFKARSHGADAVLLIAAILSDQDL
AYFVKIIRSLGMTALVEVHTLAELDRVLAIEGVSLVGINNRNLEDFSVDLETTTILLESR
RAELQAKGVRVVSESGLHTPLDLQFVKEAGAKAVLIGESLVKQLDPGKAIADLFQF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcaaatccgtcgtctccaccccagccgtcccgttaacgtcagcatcttgcag
taccaagtggcggtgcccgatgccaaaccccagcatatcctggaagaaattgtttggcat
aaagaaaaagaagtggagcaactacgcgataaggtttctctgctagagctacgtcagcgg
gtcacaacggtgccgcctgcaaaagattttctgggggccttagtccatgggaagacccag
ccagccctcatcgctgaagtaaaaaaagcctcgcctagtaagggggtaattcgggaagat
tttgaccctgtggcgatcgccaaaagttatgccgccgggggagccagttgcctctcagtc
ctcaccgataacaagtttttccagggcagcttcgaaaacctgagcctcgtgcgcgatgcg
gtggatctgcccctgctctgcaaagaatttattatttatccctatcaaatctttaaggcc
cgcagccatggtgccgatgcggttcttttgatcgccgcgatcctcagtgaccaagacctc
gcctatttcgtcaaaattatccgcagcttagggatgaccgccctggtggaagtccatacc
ctcgcggaacttgatcgcgtcctcgccattgagggggtgagcctcgtggggattaataac
cgtaacctcgaagatttttccgtcgatttggaaacaaccaccatattgctggaaagtcgt
cgcgccgaactccaggctaagggtgtccgcgttgtcagcgagtcaggcttgcatacgccc
ctggatctccagtttgtcaaagaagccggagcaaaggcagtgttaatcggcgaatctctc
gtgaaacagctggatcctgggaaggcgatcgccgacttatttcagttttag

DBGET integrated database retrieval system