KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1990Help
Entry
SYNPCC7002_A1990  CDS       T00664                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00860  Porphyrin and chlorophyll metabolism
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNPCC7002_A1990 (hemN)
Enzymes [BR:syp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     SYNPCC7002_A1990 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C DUF5456
Motif
Other DBs
NCBI-ProteinID: ACA99976
CyanoBase: SYNPCC7002_A1990
CYORF: SYNPCC7002_A1990
UniProt: B1XHQ8
Position
complement(2071309..2072706)
Genome map
AA seq 465 aa AA seqDB search
MNLACQNVRFDGQLLQKYNQAVPRYTSYPPATELTPDFDGDLFRQAIAMGNYKKTPLSLY
CHIPFCEKPCYFCGCNTIITQYKPAAATYLDYLIRHIQQVAPLVQGDRLVQQLHWGGGTP
NYLNLEQVTRLWQTLQDNFQFAPDAEISIEINPCEVSREYIFVLHQLGFKRISFGIQDFN
PQVQAAVNRIQPEEKLFEVMAWIREAGFESVNVDLIYGLPYQTLATFTETVEKTIQLNPD
RIAVFSFAYVPWLKPLQKRMPEAAMPPTAEKLEILKMTIANLTYHGYVFIGMDHFAKPND
ELAIAQQAGELHRNFQGYTTKPESDLLGFGMTSISMLQNVYAQNHKKLKDFYAAIDQQVL
PIEKGVQLSQDDLIRRTVIMELMCQFQLSAPNLENKYHLGFDLDFNDYFQAELSALNDLE
ADGLIHRSGDGFQVTPSGRLLIRNIAAVFDTYLQHKTEKTFSKAI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagcctgtcaaaatgtccgctttgatggacagctcctccaaaaatataatcaa
gcggttccccgctataccagttacccccccgcaacggaattaacccccgattttgatggg
gatcttttccgccaggcgatcgccatggggaattataaaaaaacgcccctttccctctac
tgccacattcctttttgtgaaaagccctgctatttctgtggctgcaatacgatcattacc
cagtacaaacccgccgccgctacctatctggactacctgattcgtcacattcaacaggtt
gcccccctcgtccaaggcgatcgcctggtgcaacaactccactggggtggcggcacaccc
aattatttaaacttggagcaagtgacgcgtttgtggcaaaccctccaggacaattttcaa
tttgcgcccgatgcggagatttccatcgagatcaacccctgcgaggtgagtcgcgagtat
atttttgtcttgcatcaactgggttttaagcggatcagctttggcattcaggattttaat
ccccaggtacaagcggcggtcaatcgcatccagccggaagaaaaactctttgaggtgatg
gcctggatccgcgaggcaggttttgagagcgtcaacgtagatttaatttacggcctgccc
taccaaaccctggcgacgttcacggaaacggtggaaaaaacaatccaactcaaccccgac
cggatcgctgtctttagctttgcctatgtgccctggctgaaacctctgcaaaaacggatg
cccgaagcggcgatgccccccaccgccgaaaagctcgaaatcctcaagatgaccatcgct
aatctgacctaccacggttatgtgttcatcgggatggatcattttgccaagcccaacgat
gaattggcgatcgcccaacaggcgggggaactgcaccggaatttccagggctacaccacg
aagccggaatcggatcttttgggatttggcatgacatcgatcagtatgctccagaacgtt
tacgcccagaaccataaaaagctcaaagatttttatgctgccattgatcaacaagttctt
cccatcgaaaagggcgttcaactcagccaagatgacctgattcgtcgcactgtgatcatg
gaattgatgtgtcagttccaactgtcggcccccaacctcgaaaacaaatatcacctgggc
tttgatttagactttaacgattatttccaagccgaattgagtgccctaaacgatttggaa
gccgatggtctaattcatcgttctggagatggtttccaggtgacgcccagtggtcggctg
ctgatccgcaatattgcggcggtgtttgatacctacctgcaacacaaaacggagaaaacc
ttctccaaggcgatttag

DBGET integrated database retrieval system