KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2339Help
Entry
SYNPCC7002_A2339  CDS       T00664                                 

Gene name
rfbB
Definition
(GenBank) dTDP-glucose 4-6-dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00520  Amino sugar and nucleotide sugar metabolism
syp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SYNPCC7002_A2339 (rfbB)
Enzymes [BR:syp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     SYNPCC7002_A2339 (rfbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD LAGLIDADG_3 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: ACB00317
CyanoBase: SYNPCC7002_A2339
CYORF: SYNPCC7002_A2339
UniProt: B1XJN1
Position
2414941..2416866
Genome map
AA seq 641 aa AA seqDB search
MRILVTGGAGFIGSHLIDRLMTEGHEVICLDNFYTGRKHNLLQWIGNPYFEMVRHDITEP
IRLEVDQVYHLACPASPIHYQFNAIKTVKTNVMGTLNMLGLAKRVKARILLASTSEVYGD
PEVHPQPETYHGNVNPIGIRSCYDDQTEILTDSGWVLFPELQPNQKVATLNEQNQVEYHL
PDEFIIQPYLGHLLRFNNSKFDLCVTPNHKMYVRSKTGKLKFLQADEKRHWHSWKVITGA
IFQGEELKTFTFGPPPLNAKVRFNTVFMDDWLEFLGYYLSEGCTHVRRRVRVVNGSNYDV
ADYNVLIAQENPEGRTKIAACLNRLGFKYFDSDHHQFRICSKQLAEILLPLGKSGEKYIP
REYLRLSPRQSRILFDALIMGDGSQRGNCFTYYSKSKQLADNVQELALRCGFAASVVSHA
VGRDLYRVNIRVAKDAALVEPEKVFYKGNVYCVNVKNHVVLVRRNGRVAFCGNCYDEGKR
MAETLAFDYHRSNNVDIRVARIFNTYGPNMLPNDGRVVSNFIVQALQGKPLTVYGDGSQT
RSFCYVSDLVEGLIRLMNQNFIGPVNLGNPDEYTILELAQTIQNMVNPDVEVAFEPLPQD
DPRQRQPDITRAKTYLDWQPTVPLKVGLEKTIAYFRDRLAE
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattctagtgaccggcggcgcagggttcatcggctcccatctcattgatcgcctg
atgaccgaaggccatgaagtcatttgcctcgataacttttacacaggccgcaagcataac
cttttgcagtggattggcaacccctactttgaaatggtgcgccacgacatcaccgaaccg
atccgcctcgaagtggatcaggtttaccacctcgcttgtcctgcctcaccgatccattac
cagttcaacgccatcaaaaccgttaaaaccaacgtcatgggcaccctaaatatgttgggg
ttagccaaacgggtcaaagcgagaattctgttggcgtccacctctgaagtctatggcgat
ccggaagttcatccccagccagaaacctaccatggcaacgtgaatcccatcggcattcgc
tcctgttacgacgaccaaaccgaaattttgactgattccggttgggtactcttccccgaa
ttacaacccaaccaaaaagttgccaccctcaacgaacaaaaccaagtggaatatcatctt
cccgatgagttcattattcaaccctatcttggtcacttgctgagatttaataacagcaaa
ttcgatctttgtgtgactccaaaccacaaaatgtacgtccgcagtaagacaggaaaactc
aaatttcttcaggctgatgaaaagcgtcactggcattcatggaaagtcattacaggcgca
atttttcaaggtgaagagcttaaaacttttacgtttggtcccccccctctaaatgccaaa
gttcgctttaatactgttttcatggacgattggctggaattcctgggctattatctgtcc
gaaggctgcacccacgttcgtcgtcgtgtacgggtggtaaatggcagtaattacgacgtt
gctgattataatgttctgattgcccaagaaaatcctgaaggacgcaccaagattgctgct
tgtttaaatcgtttgggctttaaatattttgattctgatcatcatcaatttaggatttgt
agcaaacaacttgctgagattctattgccattgggtaaatctggtgaaaaatatattccc
cgtgaatatctgcggttatcaccacggcaatctcgcattttgtttgatgcgctgatcatg
ggtgacggttctcaacggggtaattgttttacctattactctaaatcaaagcaactagcg
gataatgtacaagaattagccttacggtgtggctttgctgcttctgttgtgtcccatgcg
gtcggacgggatttatatcgggttaatattcgcgtagctaaagatgcggctctggtagaa
ccagaaaaagttttttacaaagggaatgtgtactgcgtcaatgtcaaaaaccatgtggtt
ttggtacgtcgtaatggtcgggttgctttttgtggtaactgttacgacgaggggaagcgg
atggcggaaaccctggcttttgattaccaccgctctaataatgttgatatccgtgtcgcc
cgaatttttaatacctatggccccaatatgttgccgaatgatgggcgggtggtgagtaac
tttatcgttcaagcgctccaggggaaaccgttgacggtctatggggatggttcccaaacc
cgcagtttttgctatgtgagtgatttggttgaaggtttgattcgtttgatgaaccaaaac
tttatcggccccgtcaatttagggaatcccgatgagtacacgattttggagttggcccaa
acgattcagaatatggtcaatcctgatgttgaagtcgcctttgagccgctaccccaggat
gatccgcgtcaacggcaaccggacattacccgtgctaaaacctacttggattggcagccg
acggtgcccctcaaggtgggcttagaaaaaacgatcgcctatttccgcgatcgcctcgca
gaataa

DBGET integrated database retrieval system