KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2438Help
Entry
SYNPCC7002_A2438  CDS       T00664                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00010  Glycolysis / Gluconeogenesis
syp00052  Galactose metabolism
syp00500  Starch and sucrose metabolism
syp00520  Amino sugar and nucleotide sugar metabolism
syp00521  Streptomycin biosynthesis
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
syp01120  Microbial metabolism in diverse environments
syp01130  Biosynthesis of antibiotics
syp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCC7002_A2438 (glk)
   00052 Galactose metabolism
    SYNPCC7002_A2438 (glk)
   00500 Starch and sucrose metabolism
    SYNPCC7002_A2438 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SYNPCC7002_A2438 (glk)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYNPCC7002_A2438 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SYNPCC7002_A2438 (glk)
Enzymes [BR:syp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SYNPCC7002_A2438 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF4872 SpoVS
Motif
Other DBs
NCBI-ProteinID: ACB00416
CyanoBase: SYNPCC7002_A2438
CYORF: SYNPCC7002_A2438
UniProt: B1XK61
Position
2531717..2532616
Genome map
AA seq 299 aa AA seqDB search
MSTVIGIDLGGTAIKGGKFSPDGLCLAEKAVPTPQPSTPTAVAEAIANLVKELNSDHSCK
AVGIGIPGPVDGTARIAKVAINLSGWQDVPLADWVEAKTGLPTTLNNDANCAGLGEAWLG
AGRDRQNLLLITLGTGVGGAVILNGKLFTGHYGAAGELGLITLNPDGPPCNSGNNGSFEQ
YCSINGVKRISGKDPGELGELAQAGDAEAIAHWQTYGKLLGAGLTSLIYIFTPEMIILGG
GISASSDFFIPAAIAEIERRVLPSSRVDLKLTKAQLGNNAGMVGAAKLALEKILNTLDN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagtgattgggattgatctggggggtacggccatcaaagggggaaaatttagc
cctgatggtctttgtttagcggaaaaagcagtacctacgccccaacccagtaccccaacc
gctgtcgccgaggcgatcgccaatttagtcaaggaacttaactcagatcacagttgtaaa
gcagtggggatcggcattcctggcccggtagatggtacagcgcgcattgccaaggttgcg
atcaatctcagtggttggcaggatgtgcccctcgcggactgggttgaggccaaaaccggt
ttacccacaacgttaaataacgatgccaactgtgccggcctgggggaagcttggttagga
gcggggcgcgatcgccaaaatctcctgctcattaccctaggaacgggagtcggtggggcg
gtaatcctcaacggaaaactttttacgggccattacggtgccgctggcgagttgggcctg
attaccctcaatcccgatggccccccctgcaatagtggtaataatggttccttcgagcaa
tattgttcgatcaatggcgttaagcggatttctggtaaagaccctggggaattaggagaa
ctggcccaggcgggagatgctgaggcgatcgcccattggcaaacctatggcaaactgttg
ggagctgggctgacaagcttaatctatattttcaccccggagatgattattctggggggc
ggcattagtgccagcagtgactttttcatcccagcggcgatcgccgaaattgaacggcgg
gtgcttccttcctcacgggtggatttaaaactgaccaaggcccagttaggcaacaatgcc
ggtatggtgggcgcagcaaaactcgccctcgaaaaaatcttaaataccctggacaattag

DBGET integrated database retrieval system