KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2827Help
Entry
SYNPCC7002_A2827  CDS       T00664                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00520  Amino sugar and nucleotide sugar metabolism
syp01100  Metabolic pathways
syp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SYNPCC7002_A2827 (nagA)
Enzymes [BR:syp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SYNPCC7002_A2827 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 PAP2_3
Motif
Other DBs
NCBI-ProteinID: ACB00796
CyanoBase: SYNPCC7002_A2827
CYORF: SYNPCC7002_A2827
UniProt: B1XN86
Position
2950213..2951376
Genome map
AA seq 387 aa AA seqDB search
MPTNHHKQRENSAQTLIRARLVGLEGQFWLRFDANRCLTHLEPMETEIPLEFQENILDIA
GDLLSLGGVDLQINGGLGLAFPEVTQTDLPRLQEICDYLWGQGIDAFCPTIVTTSLENIR
RSLAVFAKLWGDPKRNTAKILGIHLEGPFLNYEKRGAHPAQHLQPLTLKNLQQIIGEFAP
MIKIITLAPELDPSHKCVEYLRSLGIVVSLGHSLATETEANQAFARGATMITHAFNAMPS
LHHREAGLLGAAMVNPDVYCGLIADGQHVNPTMLEIFLRAAKQPFLVSDALAPIGLPDGV
YPWDDRQITVTHATARLDNGTLSGTTLPLFAGVKNLVRWGICDLEKAIALGTVAPRKALG
MATWTTGKPINLLRWQGVDGTVEFSRL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgccgactaaccatcataaacaaagggagaactctgcacaaaccctgatcagggcgcgt
cttgttggtttagaaggtcaattttggttgcgattcgatgcaaatcgttgtttaacgcat
ctggagccaatggaaaccgaaattccactagaatttcaggaaaatatcttggatattgcc
ggagatttattgtccctaggaggagtagatttacagattaacggtggtttgggtttagcg
tttccggaagtgacccagacggatctgccgagacttcaagaaatttgtgattatctttgg
ggccagggcattgacgcattttgtccgaccatcgtcaccacctctctagaaaatatccgg
cgatcgctggctgtctttgccaagctttggggagacccgaaacggaatacagcaaaaatt
ttggggatacatttagaagggccatttttaaattacgaaaaacgaggggcgcacccagcc
caacatttacagccgttgaccctgaagaatctgcaacagataatcggcgaatttgcccca
atgatcaaaatcattaccctcgccccagaactcgatcccagccataaatgtgtggaatat
ctgcgctctttggggattgttgttagtttgggtcactccctcgctacagaaacagaagcc
aatcaagcctttgcccgtggcgcaacgatgatcacccatgcctttaacgcgatgcccagt
ttgcatcaccgggaggcgggtttattgggagcagcaatggttaatcctgacgtttactgc
ggtctgatcgccgatggccagcacgtcaatcccacgatgttggagatttttttgcgggcc
gcgaaacaaccttttttagtcagtgatgccctcgcccccattggtctcccggatggggta
tatccctgggacgatcgccaaattaccgtcacccacgccacggctcgcttggataatggc
actctatccggcacgacgttaccgctgtttgccggggtcaaaaaccttgtccggtggggt
atttgtgatttagaaaaggcgatcgccttagggactgtcgccccccgaaaagccctgggt
atggcgacttggacgacgggcaaacccatcaaccttttgcgttggcaaggagtagatggc
accgttgaatttagccgactttag

DBGET integrated database retrieval system