KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_1208Help
Entry
SYNPCCP_1208      CDS       T01891                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
syq00471  D-Glutamine and D-glutamate metabolism
syq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SYNPCCP_1208 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syq01011]
    SYNPCCP_1208 (murI)
Enzymes [BR:syq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SYNPCCP_1208 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:syq01011]
 Precursor biosynthesis
  Racemase
   SYNPCCP_1208 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: BAL35294
Position
1333549..1334388
Genome map
AA seq 279 aa AA seqDB search
MREPQRSRIGVFDSGVGGLTVLRELYRQLPKESILYFGDTARLPYGKRSPQVILQYVREI
LTWMAAEEVKMVIMACNTSSALALETVQQEFNMPILGVILPGARAAVRQGRRIGVISTPA
TAASNAYRHAIHEITPDALVWQMACPEFVPLIEQNRLHDPYTLEVAKGYLQPLLDADIDT
LVFGCTHYRHLTPVFQQILPSHIRLVDPASHVVKAARQELEVMGLRNSEMSIATRFTVSG
CPQQFAELSHQWLGFTPMVEKISLPCLSSICPQPLEIRE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagccccagcgtagccgaattggcgtttttgatagtggtgtgggtgggttaacc
gttctacgtgagctgtatcgacaattacctaaagagtcaattctttattttggcgatacg
gcacggctaccttacggcaaaagatccccgcaagtaatcctccaatatgtccgggaaatc
cttacttggatggcagcagaggaagtgaaaatggtaatcatggcctgcaacaccagttct
gctctggccctggaaaccgtgcaacaggaattcaatatgccaattttgggagtgattctc
cccggggcccgggcggcagtgcgtcaaggtcggcgcatcggtgttatttctacccccgcc
actgcggccagcaacgcctatcgccatgccatccacgagatcacccctgatgcattggtc
tggcaaatggcctgcccagaatttgtgcccctaattgagcaaaaccgcctccatgacccc
tacaccctagaggtggccaagggctatttacaaccccttctggatgcagacattgacacc
ctggtatttggttgtacccactatcgtcatttaacccccgtctttcagcagattttgcct
tcccatatccgcctagtagacccggccagccatgtggtcaaagcggcccgtcaggaattg
gaagtgatgggactgcggaattcggaaatgtccattgccacccgtttcactgtcagtggc
tgcccccaacagtttgcggagctttcccaccaatggctcggttttacccccatggtggaa
aaaatttccttgccctgcttgagttcaatttgcccccaacccttggaaatacgagagtag

DBGET integrated database retrieval system