KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_1793Help
Entry
SYNPCCP_1793      CDS       T01891                                 

Gene name
putA
Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
syq00250  Alanine, aspartate and glutamate metabolism
syq00330  Arginine and proline metabolism
syq01100  Metabolic pathways
syq01110  Biosynthesis of secondary metabolites
syq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SYNPCCP_1793 (putA)
   00330 Arginine and proline metabolism
    SYNPCCP_1793 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:syq03000]
    SYNPCCP_1793 (putA)
Enzymes [BR:syq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     SYNPCCP_1793 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     SYNPCCP_1793 (putA)
Transcription factors [BR:syq03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    SYNPCCP_1793 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh PutA_N LuxC OGG_N Yop-YscD_ppl
Motif
Other DBs
NCBI-ProteinID: BAL35879
Position
complement(1965174..1968146)
Genome map
AA seq 990 aa AA seqDB search
MVAQIDSQQQYEQATQAIAKELLAQTREKRSLWDKIGDNLRLDDKLLDWTMGHPGLRVQL
FKFIDCLPALQSNSEIANHLQQYMSEEEVELPEALKKLLNFADAHSTPAQIAAGTVSKAT
EQLAFKYIAGETIAQVIKTVERLRKEKMGFTIDLLGEAVITESEAAEYWQNYLDLMAQLS
QQAKSWSKVPQIDQADGEILPQVQVSVKLTAFYSQFDPLDPAGSKAKVCERIRELLRRAQ
ELGVAVHFDMEQYHYKDLILNILKELLVEEEFRSRTDVGITMQAYLRDSTEDLEALIPWA
KHRGYPVTVRLVKGAYWDQETIKAQQNHWQIPVYVEKAQTDANYERMTRLLLENHEYLYA
AIGSHNVRSQALACAIAEELNIPKRRYEMQILYGMGEPLARAIVKRGHRVRVYAPYGRLL
PGMAYLIRRLLENTANSSFLRQNLEERPIEELIAPPQVKGINDLPTKGYGNAPDTDYADA
DLRQQAFQALTRVKQQLGKTYLPYINGEYVETANYIDSVNPCRPSQAIGKVGLISVEQAD
HALEIAKAAFPAWKKTPVRERCGILRKAADIMEERRHELNAWICLEVGKIIPQADAEVSE
AIDFCRYYADEMERLDQGVNLDIPGETNRYFYQPRGIALVISPWNFPMAIAVGMTVAALV
TGNCTLLKPAETSTVIAAKIAEILIAAGVPPGVFQYVPGKGSVVGSHMVNHPDVHLIAFT
GSREVGCRIYADAALVQPGQKHLKRVIAEMGGKNAIIVDESADLDQAVAGAVYSAFGYTG
QKCSACSRVVVLSPVHDAFVERFVEATRSLNVGPTDDPSTQVGPVIDAKAQARIQEYIEQ
GKAECELAIACDAPSEGYFVGPTVFKNVDRHATIAQEEIFGPVVTIIRAANFDEALEIAN
GTDYALTGGLYSRTPDHINRAAAEFEVGNLYINRTITGAIVSRQPFGGFKMSGVGSKAGG
PDYLLQFLEPRHVTENIQRQGFAPIEGADQ
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atggttgcacaaatcgattcacaacaacagtatgaacaggccacccaggcgatcgccaag
gaactattagcccagaccagggagaaaagatcgctgtgggacaaaattggcgataatctg
cggctcgatgacaagttgctggattggaccatgggtcatcctggattgcgggtgcaattg
ttcaaatttatcgactgtctgccagcgttgcagagtaacagtgagattgccaaccatctc
cagcagtatatgagcgaagaggaggtggaattaccagaagcactgaaaaaattgttgaat
tttgccgatgcccactcgacgccggcccagattgcagcgggaacggtgagtaaagcgacg
gaacagttggcttttaaatacattgctggggaaacgatcgcccaggtgatcaaaacagtg
gaacggctccgcaaggaaaaaatgggctttaccattgatttactgggggaagcggtaatt
acggaatcggaggcggcggaatattggcaaaattatttggacctgatggcccagttatcc
cagcaagccaaatcctggtcgaaggtgccccaaattgatcaggcagacggggaaatattg
ccccaggtgcaggtatcggtaaagttaacggctttttattcccagtttgatcccctggac
cccgcaggtagtaaagccaaggtttgtgagcggattcgggaattgttgcggcgagcccaa
gaattaggtgtcgctgttcactttgacatggagcagtaccactacaaagacctgatttta
aatattctcaaggaattgttagtggaagaagagttccgctcccgcaccgatgtgggcatt
accatgcaggcctatctgcgggattcgaccgaagatttggaagcattaattccctgggct
aaacatcggggttatcccgtgactgtgcgcttggtgaaaggagcctattgggatcaagaa
accatcaaagcccaacagaatcattggcaaattccggtttatgtggaaaaagcccaaacc
gatgccaactacgagcgcatgactcggctattactggaaaaccacgaatatttgtacgcc
gccattggtagtcataatgtccgttcccaagccctggcctgtgcgatcgccgaagagttg
aatattcccaaacgtcgttatgaaatgcagattctttacggcatgggagaacccctggcc
cgggccattgttaaacggggtcatcgggtgcgggtctatgcaccctacggtcggctgtta
ccggggatggcttatttaatccgacgcttattggaaaatactgctaacagttcttttcta
cgccaaaacctagaagagcggcccattgaagaattaattgctccgccccaagttaaaggc
attaatgacctacccaccaagggttatggcaacgctcccgacaccgattacgccgatgct
gatttacgccagcaagcatttcaagccctaaccagggttaaacaacaattgggcaaaacc
tatctgccctacattaacggcgagtacgtggaaacggctaactacattgattccgttaat
ccctgtcgtccatcccaggcgatcgggaaagtggggttaatcagtgttgaacaggcagac
catgccctggaaatagccaaggctgcgtttcctgcttggaaaaaaactccagtacgggaa
cggtgtggcattctccgcaaagcggcagacattatggaagagcgtcgccatgagttaaac
gcctggatttgtttggaagtgggcaaaattattccccaagctgatgcggaggtgtccgag
gcgatcgatttttgtcgctactatgccgatgaaatggaacggctagaccaaggcgttaac
ctcgatattcccggtgaaaccaaccgttatttctatcaaccccggggcattgccctagtg
atttccccctggaatttccccatggcgatcgccgttggtatgacggtggcggcgttggtg
acgggcaattgtacgttactaaaaccagcggaaacttccacggtaattgcggctaaaatt
gcggaaattcttattgcagcgggggttccccctggggtcttccaatatgtacctggtaag
gggtcggtggtgggttcccacatggtcaatcatcccgacgtacatttgattgctttcact
ggctccagggaagtgggctgtcgcatttacgccgatgccgctttggtacaaccaggacaa
aaacacctcaaacgggtaattgcagaaatgggcggcaaaaacgccatcatcgttgatgaa
agtgcggatctcgatcaagcggtggccggggcagtgtattccgcctttggttacacgggc
caaaaatgttctgcctgttcccgggtggtggtgctttcccccgtacacgatgcctttgtg
gagcggtttgtagaggcaacccgttccctcaatgtgggccccaccgatgaccccagcacc
caggttggtccggtaattgatgccaaggcccaagcccgcattcaggaatacatcgaacag
ggtaaggcggaatgtgaattggcgatcgcctgtgatgctcctagtgaaggctatttcgtc
ggtcccacggtgttcaaaaatgttgaccgccatgccaccattgcccaggaggaaattttt
ggtccagtggtaaccattattcgggcggccaattttgacgaagcgttggaaattgccaat
ggtaccgactacgctttaacggggggtctctattcccgtaccccagatcacattaatcgt
gccgcggcggagtttgaagtaggcaatctttacatcaaccgcaccatcaccggggcgatc
gtttcccgccaaccttttggggggttcaaaatgtctggggttggttccaaagcgggtgga
ccagattatttgttacagttcttagaaccacgccatgtaacggagaatattcaacggcaa
ggatttgcaccaattgagggggcagatcagtaa

DBGET integrated database retrieval system