KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_2218Help
Entry
SYNPCCP_2218      CDS       T01891                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
syq00860  Porphyrin and chlorophyll metabolism
syq01100  Metabolic pathways
syq01110  Biosynthesis of secondary metabolites
syq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNPCCP_2218 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:syq01007]
    SYNPCCP_2218 (hemL)
Enzymes [BR:syq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     SYNPCCP_2218 (hemL)
Amino acid related enzymes [BR:syq01007]
 Aminotransferase (transaminase)
  Class III
   SYNPCCP_2218 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAL36304
Position
complement(2469780..2471081)
Genome map
AA seq 433 aa AA seqDB search
MVNATPFITTKSEEIFAAAQHLMPGGVSSPVRAFKSVGGQPIVFDRVEGAQIWDVDGNQY
IDYVGTWGPAICGHAHPDVISALKQALDKGTSFGAPCAQENVLAEMVIDAVPSIEMVRFV
NSGTEACMSVLRLMRAFTGREKIIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPSNT
TKATLTAPYNDLEAVKALFVENPDSIAGVILEPVVGNAGFILPDAGFLEGLRELTKEYGA
LLVFDEVMTGFRVSYGGAQARFGITPDLTTLGKVIGGGLPVGAYGGREEIMAMVAPAGPM
YQAGTLSGNPLAMTAGIKTLEILQKPGSYEYLDKITKRLVDGLLAAAQDAGHEVCGGSIS
AMFGIFFAPGPVRNYEDAKLADTNKFARFHRGMLERGIYLAPSQYEAGFPSLAHTQEQID
QTIAVAKEVFATL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttggttaacgcaaccccttttattaccactaaatcagaagagatttttgccgccgctcaa
catttaatgcccggtggtgtcagttccccggtaagagctttcaagtccgtcggcggccag
cccattgtttttgaccgagtagaaggggctcagatttgggacgtagatggtaatcaatac
attgactatgtgggtacctgggggccggccatttgtggccacgctcaccccgatgtaatc
agcgccctcaaacaagctttggataaaggcaccagttttggtgctccctgtgcccaggaa
aacgtactggcggaaatggtcattgatgctgtgcctagcattgaaatggtacggtttgtc
aactccggtaccgaagcctgtatgtccgttttgcgcttgatgcgggccttcactggacgg
gaaaaaatcattaaatttgagggttgttaccacggccacgccgatatgttcttggtcaaa
gctggttctggggtggcgaccctcggtttaccggattcccctggggtgcccagtaacaca
actaaagcaacattgactgctccttataacgatctagaggcggttaaagctctgttcgtg
gaaaatcctgacagcattgccggggtaattctcgagccagtggtgggtaatgccggtttt
atcctccccgatgcgggctttttggaaggtttacgggaactgaccaaggagtatggtgct
ctgttggtttttgatgaggtgatgacaggttttcgggtttcctacggtggtgcccaagcc
cggtttggcattactcccgatttgactaccctcggtaaggtgatcggtggtggtttacca
gtaggagcctatggtggtcgggaagaaattatggccatggtggctccagccggccccatg
tatcaagcgggtaccctgtccggcaacccgttggccatgacggcgggtattaaaaccctg
gaaattctgcaaaagccaggatcctacgaatatttggataagatcaccaaacggctagtg
gatggtttactagctgcggctcaggatgcgggccatgaagtttgtggcggttccatcagt
gccatgtttggaattttctttgctcctggccctgtcagaaactatgaagatgctaagttg
gccgacaccaataaatttgcccgtttccatcggggtatgttggaaagggggatttatcta
gctccttcccagtatgaagcgggttttccttccctagcccacacccaagaacagatcgat
cagaccattgccgtcgctaaggaagtatttgctactctctga

DBGET integrated database retrieval system