KEGG   Synechococcus sp. RCC307: SynRCC307_0616Help
Entry
SynRCC307_0616    CDS       T00523                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syr01100  Metabolic pathways
syr01110  Biosynthesis of secondary metabolites
syr01130  Biosynthesis of antibiotics
syr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SynRCC307_0616 (trpC)
Enzymes [BR:syr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SynRCC307_0616 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE ThiG
Motif
Other DBs
NCBI-ProteinID: CAK27519
CyanoBase: SynRCC307_0616
CYORF: SynRCC307_0616
UniProt: A5GRL0
Position
550132..551016
Genome map
AA seq 294 aa AA seqDB search
MEIRRRPPNPKVRVAHLEYAVPHDDEAPRHILEEIVWEKDREVAQARERVPLEKLKSQVA
ALPAPRDFVAALKASCRKPAVIAEVKKASPSKGVIREDFDPEAIAKAYAEGGASCLSVLT
DKRFFQGGFEVLVQVRQVVDLPLLCKEFILSPYQLYQARAAGADAVLLIAAILTDQDISY
LLKVARSLGLQVLLEVHDAAELERALGFEGVQLIGINNRDLTSFDTDLATTETLTATYGE
QLRQSGALLVSESGLFSRDDLDRVQSAGADAVLVGEALMRQSDVQQALETLISG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaaatccgtcgccggccgcccaaccccaaggtgcgtgtggcccatctggaatacgcc
gtcccccacgacgatgaggccccgcgccacatccttgaggagatcgtttgggagaaagac
cgcgaagtcgcccaggcccgtgagcgggtgccactggagaagctgaaatcccaggtggcg
gccttgccggcgccccgtgatttcgtcgctgcgttgaaggccagctgccgtaagccggca
gtgattgctgaggtgaaaaaggctagccccagcaaaggggtaatccgcgaagactttgac
cccgaggccatcgccaaggcctatgccgaaggtggagccagctgcttgtcggtgctcacc
gacaagcgctttttccaaggtggttttgaggtgctggtgcaggtgcgccaggtggtggat
ttgcccctgctctgcaaggagttcatcctcagcccctatcagctgtatcaggcccgcgcc
gctggcgctgatgcggtgctgttgattgcagcgatcctcaccgatcaagacatcagctat
ctgctcaaagtggcccgcagccttggtttgcaggtgctgctggaagtgcatgacgccgct
gagctggagcgtgcgctcggctttgagggcgtgcagctgatcggcatcaacaaccgcgat
ctcaccagttttgacaccgatttggcgacaacagaaacgctgacggctacctacggcgag
cagttacgtcaaagcggcgcgctgctggtgagtgaatcgggtttgttcagtcgtgatgat
ctcgatcgggtgcagagcgctggggccgatgcggtgctggtgggtgaggccttaatgcgc
caaagcgatgtacagcaggccctggaaacgttgattagcggttga

DBGET integrated database retrieval system