KEGG   Synechococcus sp. RCC307: SynRCC307_0749Help
Entry
SynRCC307_0749    CDS       T00523                                 

Gene name
folD
Definition
(GenBank) FolD bifunctional protein (PPDC) (Methylenetetrahydrofolate dehydrogenase / Methenyltetrahydrofolate cyclohydrolase)
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr00670  One carbon pool by folate
syr01100  Metabolic pathways
syr01120  Microbial metabolism in diverse environments
syr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SynRCC307_0749 (folD)
Enzymes [BR:syr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SynRCC307_0749 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SynRCC307_0749 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-ProteinID: CAK27652
CyanoBase: SynRCC307_0749
CYORF: SynRCC307_0749
UniProt: A5GRZ3
Position
678736..679614
Genome map
AA seq 292 aa AA seqDB search
MPAQRLDGRQLAAQLEEVMAAAIASGLPRAGRPPGLAVLRVGDDPASGVYVANKEKACAR
VGLVSHGAHLDAATPQAEIEAKLRQLNQDPAVDGILVQLPVPAGLDDRALLLELDPAKDA
DGLHPLNLGRLLRGEPGPRSCTPAGVMALLRSNGIDPAGKRAVVIGRSILVGQPMALMLQ
AANATVTVVHSRTADLAAHTREAEILVVAAGKPGMIGADHVRPGAAVVDVGIHRKPEGGL
CGDVRSAEVEPIASALSPVPGGVGPMTVTMLLLNTVRAWSQRFDLPDPTPGY
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgccagcccagcgtcttgatggccgccagttggcggctcagctcgaggaggtgatggcc
gcggcaatcgcttctggtttgccgcgcgctggccggccgcctggcttggcggtgctgcgt
gttggcgacgatccggcaagcggtgtgtatgtggccaataaagagaaagcctgcgcccgt
gtgggcttggtgagccatggcgcccacctcgatgcagccaccccccaggccgagattgag
gccaagttgcggcagttgaaccaggatcccgccgtcgatggaatcctcgtgcagttgccg
gtgcccgctggtctggatgatcgggccctgctgctggagctggatccagccaaagacgcc
gatggtctgcatccgctcaatctgggccgcttgttgcggggagagcccggtccgcgcagc
tgcacgccggctggggtgatggccctgctgcgcagcaacggcatcgatcccgctggcaaa
cgggccgtggtgattggccgcagcatcctggtgggccagccgatggcgctgatgttgcaa
gcggccaatgccacggtcacggtggtgcattcgcgaactgctgatttagcggcccacacc
cgtgaagccgagattttggtggtggctgccggcaagccagggatgatcggcgccgatcat
gtgcgccctggagccgcggtggtggatgtggggattcaccgcaagccggaaggagggtta
tgcggggatgtgcgctctgccgaggtggagcccatcgcctcagccctatcgcctgtgccc
ggcggagtggggccgatgacggtgacgatgctgctgctcaataccgtgcgggcttggagc
cagcggtttgatctgccggatccaacccctggttattaa

DBGET integrated database retrieval system