KEGG   Synechococcus sp. RCC307: SynRCC307_0787Help
Entry
SynRCC307_0787    CDS       T00523                                 

Gene name
gldA
Definition
(GenBank) Glycerol dehydrogenase related protein
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr00561  Glycerolipid metabolism
syr00640  Propanoate metabolism
syr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SynRCC307_0787 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SynRCC307_0787 (gldA)
Enzymes [BR:syr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SynRCC307_0787 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: CAK27690
CyanoBase: SynRCC307_0787
CYORF: SynRCC307_0787
UniProt: A5GS31
Position
complement(716680..717783)
Genome map
AA seq 367 aa AA seqDB search
MSSTISSHAIAPANVLRGSGAWGEALSLIAELCQKPFVLGRSNATADLRQTLRSDLEATG
LSVDTGELEFDCCEQDLQRLATEIRACGCDAVLAAGGGKVLDAGKLLADRLGLTCITVPT
SAATCAGWTALANIYSPQGAFEGDVALRHCPELLIFDHDLVVQAPARTLASGIADAMAKW
YEASVSSSSSTDGLVQQAVQQARVLRDQLLLEGLEAIEHPGSGAWQRVAEASGLTAGLIG
GIGGARCRTVAAHAVHNGLTQLAACHGVLHGEKVGFGILVQLRLEEQLGGSQLAAQARRQ
LFSFFRQLQLPVSLEELGLAGASLQELQEVCRFACCDGSDLHHLPFAVSPDDLLSALVSS
SQGCLTH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaccatctcgtcccacgccattgctccagccaacgtgctgcgcggcagtggc
gcatggggcgaagcgctttcgttgattgccgagctgtgccaaaagccgtttgtgctcggc
cgcagcaatgccacagcggatttgcgccaaacactgagaagtgatctcgaggcaacaggc
ctgtctgttgacactggagagctggaattcgattgctgcgagcaagatctgcagcgctta
gccactgagatcagagcctgcggctgcgatgcggtcttggcggccggcgggggcaaggtg
ctggatgccggcaagctgctggctgaccgcctgggtttgacctgcatcacggtgcccacc
agcgccgccacctgcgccggctggaccgcactggccaacatctattcaccgcaaggggcc
tttgagggcgatgtggccctgcgccactgccccgagctgttgatctttgaccacgatctg
gtggttcaggctccggcgcgaaccctggcgagcggcatcgctgatgcaatggccaagtgg
tatgaggcatcagtgagcagcagctccagcaccgatggactggtgcagcaggcggtgcag
caagcccgcgtgctgcgcgatcaactgctgctcgagggactggaagccatcgagcatcct
gggtctggggcctggcaacgcgtggccgaagccagtggtctcaccgccgggttgattggc
ggcatcggtggtgctcgctgccgcactgtggccgcccatgcggttcataacggcctcacg
cagttagccgcttgccatggcgtgctgcatggcgagaaggttggttttgggatcttggtg
cagctgcgcctggaagagcagctggggggcagccaactagccgcacaagcccgccggcaa
ctgttcagctttttccgtcagttgcaattgcccgtgagcctggaggagctggggctggct
ggcgccagcttgcaggaactgcaagaggtgtgccgctttgcctgctgcgatggctccgat
ctgcaccatctgccttttgcggtgtcccccgatgatctgctctccgcactcgtgagcagc
agccagggatgtctgacgcactaa

DBGET integrated database retrieval system