KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_1012Help
Entry
SYNPCCN_1012      CDS       T01778                                 

Gene name
cobL
Definition
(GenBank) precorrin-6B methylase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
sys00860  Porphyrin and chlorophyll metabolism
sys01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sys00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNPCCN_1012 (cobL)
Enzymes [BR:sys01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     SYNPCCN_1012 (cobL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_4 PCMT Methyltransf_25 MTS Methyltr_RsmB-F GidB RrnaAD Methyltransf_18 Methyltransf_11 Cons_hypoth95 Methyltransf_12 Methyltransf_24 DOT1 Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: BAL31929
Position
1120159..1120752
Genome map
AA seq 197 aa AA seqDB search
MLWPYKTPGITDGLFERLPGIPLSKREVRLLIISALQLKEESIIWDIGAGTGTIPVELAL
LCPRSRIVAVERDEEVAGLIRRNCERFGVTNVTVHEGSAPDCLPQLIAHPTHICIEGGRP
IKQILQETWAHLAPGGRLVATANNLESLYGISETLSELQVRNVEVVQAGVNRLEKRGLQQ
IFAAVDPTFILAGEKLS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgctctggccctataagaccccaggaattacagatggcctgtttgaacgattaccgggc
attcccctcagcaaaagggaggtacgcctgctgattatttccgctttgcaattgaaggag
gaatccatcatttgggatattggggctggcactggcaccattccggtggaactagcccta
ctgtgtccccgcagtcgcattgtggcggtggaaagggatgaggaggtggcgggtttaatt
cgccgtaactgcgaacggtttggggtaactaatgtgactgtccatgagggcagtgctccg
gattgcttaccgcagttaattgcccaccccacccatatttgcattgagggagggcgtccc
attaagcaaattttgcaggaaacctgggcccatttagctcccggaggtcgtttagtggca
acagcgaataatttggaaagtctctatggcatttctgaaaccctgtcggaactccaggtc
cgcaacgtggaggtggtgcaagcgggggtaaatcgtctagaaaaacgtggtttacaacag
atttttgcagcggtggaccctacttttattttggcgggagaaaagttgtcttag

DBGET integrated database retrieval system