KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_1136Help
Entry
SYNPCCN_1136      CDS       T01778                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
sys00471  D-Glutamine and D-glutamate metabolism
sys00550  Peptidoglycan biosynthesis
sys01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sys00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SYNPCCN_1136 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SYNPCCN_1136 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sys01011]
    SYNPCCN_1136 (murD)
Enzymes [BR:sys01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     SYNPCCN_1136 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:sys01011]
 Precursor biosynthesis
  Amino acid ligase
   SYNPCCN_1136 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C TrkA_N NAD_binding_8 Pyr_redox_2 NAD_binding_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAL32053
Position
complement(1255965..1257323)
Genome map
AA seq 452 aa AA seqDB search
MPQACVIGLGRSGIAAARVLHRDGWQVTVFDQADNDQLRHMGQPLVQEGISLKLGDRLDP
VKEAWPERIVVSPGVPWDIPLLVAAREKGVEVTGELELAWQYLHAVPWVGITGTNGKTTT
TSLVQAIFQKAGLNAPACGNIGYAACELVLQNQNYDWIVAEISSYQIESSPTLAPQIGLW
TTFTPDHLSRHKTLENYFNIKASLLSRSAIQVLNGDDPHLHSHGPNLYPQAHWTSTQGAN
HLAGLCDPKQGVYLQDNWVNAFGELIAPINLFKMPGQHNQQNLLMAIAAARLAGIDKKAI
TETLLTFTGVPHRLEPICTINGVQFINDSKATNYDAAEVGLSSMKGPTILIAGGEAKEGD
DQAWLAQIRQKAVAVLLIGDAAPNFATRLKAVGYENYEIVETMANAVQRGLELASKNNAS
AVLLSPACASFDQYNSFEERGEDFRACCLGLV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggcttgtgtaattgggttaggacgttccggtattgccgccgctcgagtgttg
catcgggatggctggcaggtgacggtatttgatcaggcggataacgaccaactccggcat
atgggacaacccttggtccaggaaggaatcagcctcaaactaggcgatcgcctggaccca
gttaaggaagcttggcccgaacgcattgtagtgagcccaggagtgccctgggatattcct
ctgttggtggcggcccgggaaaagggagtggaagtgacaggggaattggaattagcttgg
cagtacctccatgcggtgccttgggtgggcattacgggcaccaacggaaaaaccaccacc
acctctttagtacaagcaatttttcaaaaagctgggctgaatgctccggcctgcggcaac
attggctatgcggcctgtgaactggtcttgcaaaaccaaaactacgattggattgtggcg
gaaattagcagttatcaaattgagtcttcccccacccttgcaccccaaattggtctctgg
acaacctttacgccggatcacctcagtcgtcacaaaaccctagagaattatttcaacatt
aaagctagtttgctttcccgctccgccatccaggtgctcaacggcgatgatccccatctc
cacagccacggccccaacctttacccccaagcccattggactagtacccagggagctaat
catctggctggtctttgtgatcccaaacagggggtttacctccaggataattgggttaat
gcctttggggaattaattgcccccattaacctgttcaaaatgcctgggcaacataaccaa
caaaatttactaatggcgatcgccgccgcccgtttagcgggcatagacaaaaaagcgatc
acagagaccttgttaactttcaccggggtaccccatcgtttggaacccatttgcaccatc
aatggagtgcaatttatcaatgatagtaaggccaccaactatgatgcggcggaagtaggg
ctatcttccatgaaaggccccaccattctgatcgcagggggagaagcgaaagaaggggat
gatcaagcttggttagcccaaattaggcaaaaagcggtggcggttttactgattggtgat
gcagcccccaactttgcaaccaggttaaaggcagtgggttatgagaattacgaaatagtg
gaaaccatggccaatgccgttcagcgaggattagagttagcaagtaaaaacaatgccagt
gcagtcttgctttccccggcctgtgccagtttcgaccaatataatagctttgaggaacgg
ggagaagatttccgtgcctgttgtttaggattggtttag

DBGET integrated database retrieval system