KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_1535Help
Entry
SYNPCCN_1535      CDS       T01778                                 

Gene name
rfbB
Definition
(GenBank) dTDP-glucose 4-6-dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
sys00520  Amino sugar and nucleotide sugar metabolism
sys01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SYNPCCN_1535 (rfbB)
Enzymes [BR:sys01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     SYNPCCN_1535 (rfbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 adh_short KR NmrA NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: BAL32452
Position
1689021..1689950
Genome map
AA seq 309 aa AA seqDB search
MRILVTGGAGFIGSHLIDRLMAQGHEVLCLDNFYTGTKRNIVQWLDNPNFELIRHDVTEP
IRLEVDQVYHLACPASPVHYQFNPVKTIKTNVMGTLYMLGLAKRVGARFLLASTSEVYGD
PDVHPQPESYRGNVNTIGPRACYDEGKRVAETLAFEYYREHKVDIRVARIFNTYGPRMLE
NDGRVVSNFIVQALQGKPLTVFGDGSQTRSFCYVSDLVEGLMRLMNGDYVGPVNLGNPGE
YTILQLAEKIQNAINPDAELIYQPLPEDDPKQRQPDITLAKTYLDWQPTIPLDQGLAMTI
EDFKSRHEG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcggattttggttaccgggggagcaggatttatcggttcccatcttattgatcgcttg
atggcccagggccacgaggttctatgcctcgataacttttacaccggcaccaaacgcaac
atcgtccaatggttagataatcccaattttgagctcatccgccatgacgttaccgagccc
attcgcttggaagtcgaccaggtttaccatttagcctgccccgcttcccccgtccattat
cagttcaatcccgtcaaaaccatcaaaactaatgtgatgggcactttatacatgttgggt
ttggctaagcgggtcggagcaaggtttttgttggcatccacctcggaagtgtatggcgat
cccgatgttcatccccaaccggaaagctaccggggcaatgttaatacaattggtccaaga
gcctgttacgacgaaggaaaacgggtagcggaaaccctggcttttgagtattaccgagag
cacaaggttgatatcagagtagcgcggatattcaatacctatggaccacgtatgttggaa
aacgatggtcgggtggtgagtaactttattgtgcaggcgctacagggtaaacccctcact
gtgtttggcgacggctcccaaacccgcagtttttgttacgtatccgacttagtggaaggc
ctaatgcgcctcatgaatggggattacgtcgggccggttaatttgggtaatccgggggaa
tataccatattgcaactggcagaaaaaatccagaatgccattaaccccgatgcagagtta
atttatcaacccttaccggaggatgatcccaaacagcggcaaccggatattacgttggcg
aaaacttatttagactggcaaccgaccattcccctagatcaaggtttggcaatgactatc
gaagatttcaaatctcgccacgaaggatga

DBGET integrated database retrieval system