KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_1182Help
Entry
SYNGTI_1182       CDS       T01777                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
syt00260  Glycine, serine and threonine metabolism
syt00750  Vitamin B6 metabolism
syt01100  Metabolic pathways
syt01110  Biosynthesis of secondary metabolites
syt01120  Microbial metabolism in diverse environments
syt01230  Biosynthesis of amino acids
Module
syt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNGTI_1182 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SYNGTI_1182 (thrC)
Enzymes [BR:syt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SYNGTI_1182 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAL28929
Position
complement(1302214..1303515)
Genome map
AA seq 433 aa AA seqDB search
MTTATTTAPEFISACTKLVSKEGNTEYPLKALHICEETFAPLEVAYDYDLIRRHVTRETI
EAGPNSIWRYRAFLPVTGKDVIDVGTGMTPLVKSHRLARRLGLKNLYIKNDAVNMPTLSF
KDRVVSVALTRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGTL
IYNPTLMAVKGNYDQVNRLCCEVGNSYGWGFVNINLRPYYSEGSKTLGFEVAEQLGWKLP
DHIVAPLASGSLFTKIHKGFQEFIKVGLVDDKPVRFSGAQAEGCSPIATAFQEGRDFVKP
VKPNTIAKSIAIGNPADGVYALDIARKTNGNIESVNDAEIIEGIKLLAETEGIFTETAGG
TTVAVLKKLVEAGKIDPEETTVVYITGNGLKTQEAVQSHVGEPLTIDANLDSFERALERS
RTLERLEWQQVLV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgccaccaccacggctccagaatttatttccgcttgtaccaaactggtttcc
aaggaaggcaataccgaatatcccctcaaagcactacacatctgtgaggaaacctttgct
cctctggaagtggcctacgactacgatttaatccgccgccacgttacgagggaaaccatt
gaagcgggtcctaattccatttggcgttaccgcgcctttctgcccgtcactggtaaagat
gtaattgatgtgggcactggcatgacccccttggttaaatcccatcgtttagcccgccgc
ctggggctgaaaaatctctacattaaaaacgatgcggttaatatgcccaccttgagcttc
aaggaccgggtggtgtccgttgctctgaccagggcccgggaattgggcttcaccaccgtt
tcctgcgccagcaccggtaatttggccaactccactgcggcgatcgccgcccatgccggt
ttggactgctgtgtgtttatcccggcggatttggaagcaggcaaagtattggggaccttg
atttacaatcccaccctaatggcagtgaaaggcaactatgaccaggtcaatcgtctctgc
tgtgaagtgggcaacagctacggctggggtttcgtgaacattaacctgcgcccctactac
tccgaaggctccaaaaccctgggctttgaggtggcggaacaattgggttggaaattgccc
gaccacattgtggctcccctcgcttccggttccctgttcaccaaaatccacaagggcttc
caagaatttatcaaagtcggtttggtggatgataagccagtgcgtttcagtggtgcccaa
gcagagggttgttcccccatcgccactgctttccaagagggccgggactttgttaagcca
gtcaaacccaacaccattgctaaatccattgccatcggcaaccccgctgacggagtttat
gccctggacattgcccgcaaaaccaatggcaacattgaaagcgtcaacgatgccgaaatt
atcgaagggatcaagctgttggcggaaaccgaaggcatctttaccgaaaccgctgggggc
accaccgttgcagtgctgaaaaaactagtggaagcgggcaaaattgatcccgaagaaact
acggtggtctacatcactggtaatggtttaaaaacccaggaagcggtacaaagccatgtg
ggagaacccctcaccatcgatgccaacctggatagctttgagcgggccctggagcgctcc
cgcacgttggaacgcttggaatggcaacaggttttggtctag

DBGET integrated database retrieval system