KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_2848Help
Entry
SYNGTI_2848       CDS       T01777                                 

Gene name
chlM
Definition
(GenBank) Mg-protoporphyrin IX methyl transferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
syt00860  Porphyrin and chlorophyll metabolism
syt01100  Metabolic pathways
syt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNGTI_2848 (chlM)
Enzymes [BR:syt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     SYNGTI_2848 (chlM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_11 Methyltransf_31 Methyltransf_18 CMAS Methyltransf_32 MTS PrmA DREV TPMT UPF0020 TehB Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: BAL30595
Structure
PDB: 

Position
3180033..3180725
Genome map
AA seq 230 aa AA seqDB search
MTNAALDDKTIVRDYFNSTGFDRWRRIYGDGQVNFVQKDIRVGHQQTVDSVVAWLVADGN
LPGLLVCDAGCGVGSLSIPLAQAGALVYGSDISEKMVGEAQQKAQEVLAYGNQPTFMTQD
LAQLGGKYDTVICLDVLIHYPTEEASAMISHLASLADRRLILSFAPKTLGLTVLKKIGGL
FPGPSKTTRAYQHKEADIRKILGDNGFSIARTGMTSTRFYYSRILEAVRS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgccgccctagacgataaaaccatcgttcgtgactattttaattccaccggc
tttgaccgttggcgccggatctatggtgacggccaagtcaatttcgtgcaaaaagacatc
cgggtggggcatcaacaaaccgttgactcggtggtggcctggttagtggcggacggaaat
ttacctggcttgttagtctgtgatgcgggatgtggggtaggtagtttgagcattcccctg
gcccaagcgggggcattggtctatggcagtgatatttccgaaaaaatggtgggggaagcc
caacaaaaggcccaggaagttttggcctatggcaatcagcccacgtttatgacccaggat
ttagcccagttggggggtaaatatgacacagttatttgtctggatgtgttgattcactat
ccaacggaggaggcgtcagcgatgattagccacttggcttccctggctgatcgccgttta
attttgagctttgcccccaaaaccctgggcttgacggtgttgaaaaaaattgggggactg
tttcccggtcccagtaagaccaccagggcctatcaacataaagaagcagacattcgcaaa
attttgggagataacggcttttccattgcccgtaccggcatgaccagtacccgtttctac
tattcccgtattttagaggcggtgcgctcttaa

DBGET integrated database retrieval system