KEGG   Synechococcus sp. UTEX 2973: M744_09430Help
Entry
M744_09430        CDS       T03581                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
syu  Synechococcus sp. UTEX 2973
Pathway
syu00740  Riboflavin metabolism
syu00790  Folate biosynthesis
syu01100  Metabolic pathways
syu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    M744_09430
   00790 Folate biosynthesis
    M744_09430
Enzymes [BR:syu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     M744_09430
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     M744_09430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AJD58035
Position
1777756..1779441
Genome map
AA seq 561 aa AA seqDB search
MTLPEDFQFDAIADAIAEIKAGRSVVVVDDENRENEGDLICAAQFATPEMINFMAVEARG
LICLAMTGDRLDQLDLPLMVDRNTDSNQTAFTVSIDAAPHLGVSTGISAEDRARTIQATI
NPLTKPHDLRRPGHIFPLRSREGGVLKRAGHTEAAVDLARMAGLYPAGVICEIQNPNGSM
ARLPDLIDYARQHRLKLISIADLISYRLQHERFVIRETIATLPSEFGQFTIFAYRNSLDG
SEHVALVKGDPSRFSQQPVMVRVHSECLTGDAFGSLRCDCRMQLQAAMKMIENAGQGVIV
YLRQEGRGIGLINKLKAYSLQDLGLDTVEANARLGFPADLRNYGVGAQILNDLGVTRIRL
ITNNPRKIAGLKGYGLEVVDRVPLLIEATPYNSSYLATKGEKLGHLLLKTHLAAIALHLT
PELQNNPYRQTLIGQIRSLVQGEGLFLQEELRSVASALFGPQVLTLQVGLAQSEAIAADW
YRSPDSPLADQLQHCLEQMAAIDGLEDLEFLLADGHDPLTSLQVQLDRQSLPLPDLSRQF
KTLKLQQIYHLQLQERPSFVS
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgccagaagactttcagtttgatgcgatcgccgacgcgatcgcggaaatcaaa
gccggtcgctcggtggtggtggttgacgatgaaaaccgcgaaaacgaaggtgacctgatc
tgtgcggctcagtttgccacccccgaaatgatcaacttcatggcggtggaagccagaggc
ttaatctgtctggctatgacgggcgatcgcctcgatcaactcgatttgccgctgatggtc
gatcgcaacaccgacagcaatcaaactgcctttaccgtcagcattgatgcggccccccat
ctcggcgtcagcactggtatttctgctgaggatcgggcgcgaacgattcaagccacgatc
aatcccctgaccaagccccacgatctgcgccgccccggtcacatttttccgctgcgatcg
cgggagggcggtgtcctcaagcgggctggacataccgaagccgctgtcgatctagcacgg
atggctgggctctatcccgctggggtgatctgtgagatccagaatcccaatggatcgatg
gcgcggctgccggatttgattgactacgctcgtcagcatcggctgaaactgatcagcatt
gctgatctgatcagctatcggctgcaacatgagcgcttcgtgattcgcgaaacgatcgcg
actttgccgagtgagttcgggcagttcacgatttttgcctaccgcaacagcttggatggc
tcagagcatgtggcgctggtcaagggcgatcccagccgctttagtcagcagccagtcatg
gtgcgcgttcactccgaatgtctgaccggtgatgccttcggttcactgcgctgcgattgc
cggatgcagctgcaggccgcgatgaagatgattgaaaatgctggtcagggcgtgattgtc
tacctacggcaagaaggtcgtggcattggcctaatcaacaaactcaaggcttattcacta
caagatttggggctagataccgtcgaagccaacgcccgccttggctttccggctgacctg
cgcaattacggcgtgggggcgcaaatcctcaacgacctaggggtaacgcgcattcgtctg
atcaccaacaatccccgcaaaattgccggcctcaagggctatggactagaagtggtcgat
cgcgtccccctgctgattgaagccaccccctacaattcgtcttatctggcgactaagggt
gaaaaactcggccacttgctcctcaaaacccatctagccgcgatcgctctgcatctcacg
ccggaattacagaacaatccctatcgccaaacgctgattggtcagattcgcagtctggtg
caaggagagggattattcctgcaagaagagctgcgatcggtggcgtcagcgctctttggc
ccccaggtcctaaccctgcaggtcggcttggcccagtcagaagcgatcgcagcggactgg
taccgctcgcccgattccccactggccgaccagctgcagcattgcttggaacaaatggct
gcgatcgatggcttagaagatctggaatttctgctggcggatggtcatgacccgctaact
agcttgcaggtgcagctcgatcgccagtcgttaccgctaccggatctgagccgccagttc
aaaaccctgaagctgcagcagatctatcacttacagctgcaggaacgaccgagctttgtc
agctga

DBGET integrated database retrieval system