KEGG   Synechococcus sp. UTEX 2973: M744_10575Help
Entry
M744_10575        CDS       T03581                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
syu  Synechococcus sp. UTEX 2973
Pathway
syu00480  Glutathione metabolism
syu00590  Arachidonic acid metabolism
syu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    M744_10575
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M744_10575
Enzymes [BR:syu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     M744_10575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AJD58242
Position
complement(2026946..2027428)
Genome map
AA seq 160 aa AA seqDB search
MAPQVTDIAVTTIDGAAKSLSDYAGQVLLIVNVASYCGYTSQYSGLEALYRQYRDRGLQV
LAFPCNDFGAQEPGSNEEIKTFCSTRFDVSFELFDKVHAKGADQHPLYAALTQTDPAGDV
AWNFEKFLVGKDGTVLARFKSGVAPNDASLIQAIEAALAA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcaagtcactgacatcgccgtcacaaccatcgacggtgcagcgaaaagcctc
agcgactacgccggtcaggtgttgttgattgtcaacgtggcctcctactgcggttacacc
tcgcagtacagcggcttggaagccctctatcgccaataccgcgatcgcggtctgcaggtc
ttggcgttcccctgcaatgactttggggcccaggaaccgggcagcaatgaggagatcaaa
accttctgctccactcgtttcgatgtcagcttcgaactgttcgataaagtccatgccaaa
ggcgcggatcaacatcctctttacgcagcgctgacgcaaacggaccctgccggtgacgta
gcttggaactttgagaaatttttggtcggcaaggatggcactgtcttagcccgcttcaag
agtggcgttgcccccaacgatgccagcctgattcaagcgatcgaagcagcactcgctgcc
taa

DBGET integrated database retrieval system