KEGG   Synechococcus sp. PCC 73109: AWQ23_14025Help
Entry
AWQ23_14025       CDS       T05693                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
syv  Synechococcus sp. PCC 73109
Pathway
syv00790  Folate biosynthesis
syv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AWQ23_14025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syv04147]
    AWQ23_14025
Enzymes [BR:syv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     AWQ23_14025
Exosome [BR:syv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWQ23_14025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AMA10340
Position
2947797..2948075
Genome map
AA seq 92 aa AA seqDB search
MATRLTDTEIQAQLSQFPEWSKVDNKIQRRFKFKNFIEAIDFVNKLVEPAEAADHHPDIE
ISYNKVTVNLTTHDAGGLTQKDFDLAGTFDQL
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccgattgaccgacaccgaaatccaagcacaattgagtcaatttcctgaatgg
tcaaaggttgataacaaaattcaacgccgatttaagttcaaaaactttattgaggcaatt
gactttgtaaacaaactcgtcgaaccggccgaagctgccgaccatcaccccgacatcgag
atttcctacaacaaagtcaccgtaaacctaaccacccacgacgctggcggccttacccaa
aaagattttgatctcgccggaactttcgatcaactgtaa

DBGET integrated database retrieval system