KEGG   Synechococcus sp. WH8102: SYNW0030Help
Entry
SYNW0030          CDS       T00144                                 

Gene name
gap2
Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase (NADP+)
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00010  Glycolysis / Gluconeogenesis
syw00710  Carbon fixation in photosynthetic organisms
syw01100  Metabolic pathways
syw01110  Biosynthesis of secondary metabolites
syw01120  Microbial metabolism in diverse environments
syw01130  Biosynthesis of antibiotics
syw01200  Carbon metabolism
syw01230  Biosynthesis of amino acids
Module
syw_M00002  Glycolysis, core module involving three-carbon compounds
syw_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syw_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syw_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNW0030 (gap2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNW0030 (gap2)
Enzymes [BR:syw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     SYNW0030 (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: CAE06545
CyanoBase: SYNW0030
CYORF: SYNW0030
UniProt: Q7UA70
Position
30250..31275
Genome map
AA seq 341 aa AA seqDB search
MTLRVAINGFGRIGRNVMRGWISRGADTGLEIVGMNSTSDPKTSAHLLTYDSILGKLDPS
VKIETTDDTMLVNGKEIKFFADRNPLNCPWKDWGVDLVIESTGVFNTDEKASMHLEAGAS
KVILTAPGKGDGVGTFVVGVNDDQYRHEDWNILSNASCTTNCLAPIVKVLDQNFGLDWGL
MTTIHSYTGDQRILDNSHRDLRRARAAALNMVPTTTGAAKAVALVYPEVKGKLTGFAMRV
PTPNVSAVDLTFGPSRATSVDEVKAVIKAASENGMKGIIKYSDLPLVSTDYAGTNESTIF
DADLTYAMGDKAVKILAWYDNEWGYSQRVVDLAEVVARNWK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgcgttgcgatcaatggattcggccgaattggtcgcaatgtgatgcggggt
tggatcagccgtggtgctgatacgggcctggagatcgtgggtatgaactccacgtccgat
cccaagaccagcgctcacctgctgacctacgactcgatccttggcaagctcgatcccagc
gtcaagatcgaaaccaccgacgacaccatgctggtcaacggcaaggagatcaagttcttc
gctgaccgcaaccccctgaactgcccttggaaggactggggtgtcgatctggtgatcgaa
tccactggtgtgttcaacaccgacgaaaaagccagcatgcacctcgaggcaggcgccagc
aaggtgatcctgactgcccctggcaaaggtgatggcgtcggcactttcgtggtgggagtc
aatgacgaccagtaccgccatgaggactggaacatcctctccaacgccagctgcaccacc
aactgcctggcccccatcgtcaaggttctggatcagaacttcggcctcgactggggtctg
atgaccaccatccacagctacaccggcgaccagcggatcctggacaacagccaccgcgac
ctgcgtcgcgcccgtgctgctgctctgaacatggtccccaccaccaccggtgcggccaag
gctgtggccctggtataccccgaggtgaagggcaagctcaccggtttcgccatgcgcgtt
cccacccccaacgtatctgccgttgacctcaccttcggaccgtcccgtgccaccagcgtt
gatgaggtgaaggctgtgatcaaggccgcttctgagaacggcatgaagggcatcatcaag
tacagcgacctgcccctggtctccaccgattacgccggcaccaacgaatccacaatcttt
gatgccgacctcacctacgcgatgggcgacaaggctgtgaagatcctggcctggtacgac
aacgagtggggttacagccagcgcgttgttgatctggctgaagtggtggcccgcaactgg
aagtga

DBGET integrated database retrieval system