KEGG   Synechococcus sp. WH8102: SYNW0782Help
Entry
SYNW0782          CDS       T00144                                 

Gene name
proB
Definition
(GenBank) putative glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00330  Arginine and proline metabolism
syw00332  Carbapenem biosynthesis
syw01100  Metabolic pathways
syw01130  Biosynthesis of antibiotics
syw01230  Biosynthesis of amino acids
Module
syw_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SYNW0782 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SYNW0782 (proB)
Enzymes [BR:syw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SYNW0782 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAE07297
CyanoBase: SYNW0782
CYORF: SYNW0782
UniProt: Q7U842
Position
762124..763197
Genome map
AA seq 357 aa AA seqDB search
MTLWVVKLGTSLLRGDTAATIAGFAAGIAAAFARGDRVVLVSSGAVGLGCQRLQLPQRPE
TVVALQAAAATGQGQLMALYERALANHGIAVAQILVTRSDLADRRRYQNASGTLQQLLQW
GVLPVVNENDAISPAELRFGDNDTLSALVAAAVGADQLILLTDVDRLYSADPRLVVDARP
ISDVHHPRELDALEAVAGDGGRWGRGGMTTKLAAARIATASGITVHLADGRDPRRLDALL
QGERGGTVFHPHPEPLGNRRSWLAHALQPQGELTLDAGACDALHQRGSSLLMVGITAVKG
VFGANQPVRLQGPDGRELGRGLCQLSSAAVQRALDAAPAAGPSPVVVHRDALVLHSR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgtgggtggtgaagctgggcacgagcttgttgcggggggataccgccgcaacg
atcgctggtttcgccgcaggcattgctgctgccttcgcaaggggcgatcgcgttgtgctg
gtttccagtggtgctgtcggcctcggttgccagcggcttcagcttccccagaggcccgag
accgtggtggccctgcaggcggcggctgccaccgggcagggtcagctgatggctttgtac
gaacgggccttggcgaaccacggcatcgctgtggcccagatccttgtcacccggtcagat
ctggctgatcgtcgccgttatcagaacgcctcaggaaccctgcagcagctgttgcagtgg
ggtgtgttgccggtggtcaatgaaaacgacgctatctccccggcggagctccgcttcgga
gacaacgacaccctgtctgccctagtggcggcggccgttggtgccgaccagctcatcctg
ctcaccgacgtggaccgtctgtactcagccgatccgcggcttgtcgtcgatgcccgcccg
atttccgatgtgcaccacccacgggagctcgacgcccttgaagccgtcgccggtgatggc
ggacgttggggccgcggcggcatgaccaccaagctggcggcggccaggattgccaccgcc
agcggcatcactgtgcatctggcagatggtcgggatcccaggcgcctcgatgccctgctt
cagggggaacgcgggggaacggtgtttcatccccacccggaacccctgggcaaccgtcgc
agctggctggctcatgccttgcaaccccagggcgagctgacgctggatgccggtgcctgc
gatgccttgcatcagcgggggtcctccctgttgatggttgggattactgcggtgaagggg
gtgttcggcgccaatcaaccggtccggttgcagggtcctgacggccgcgagctgggacgc
ggcctttgccagctgtccagcgcagctgttcagcgcgctcttgatgctgcgccggccgct
ggtccatcgcctgtggtggtgcatcgggacgccctggtgcttcacagccgctga

DBGET integrated database retrieval system