KEGG   Parasynechococcus marenigrum: SYNW1524
Entry
SYNW1524          CDS       T00144                                 

Name
(GenBank) putative sulfate transporter
  KO
K03321  sulfate permease, SulP family
Organism
syw  Parasynechococcus marenigrum
Brite
KEGG Orthology (KO) [BR:syw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syw02000]
    SYNW1524
Transporters [BR:syw02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SYNW1524
SSDB
Motif
Pfam: Sulfate_transp STAS Xan_ur_permease HCO3_cotransp STAS_2
Other DBs
NCBI-ProteinID: CAE08039
CyanoBase: SYNW1524
CYORF: SYNW1524
UniProt: Q7U617
Position
complement(1466553..1468223)
AA seq 556 aa
MTLGRIVLNRINATNLKGDVFGGLTAAVIALPMALAFGIASGAGAAAGLWGAVIIGLVAS
LFGGTPTLISEPTGPMTVVFTSVIISFTATADSPEQALAMAFSVGVLAGIFQILFGLFRL
GRYVTMMPYTVISGFMSGIGIILVLLQLGPFLGQATPKGGVMGTLLEMPALVQGTQPMEL
LLALITLAILWFTPSAVKKVCPPQLLALVVGTVLALSLFSGAGLRTIPEFSAALPSFQLP
TFSSGQLRLMVIDAAVLGMLGCIDALLTSVVADSLTRTEHNSNKELIGQGLANVVSGLFG
AMPGAGATMGTVVNIQSGGRTALSGIVRAMVLMLVVLLAAPLASRIPLAVLAGIAVKVGI
DIMDWDFLQRAHHLSVKAAVITYGVIALTVLVDLIAAVGIGVFVANVLTIDRMSTLQSKK
VKTISTTDDDVELSDEEQQLLDRASGMVLLFQLAGPMIFGVAKAISREHNAIGNCQAVVF
DLSEVSHLGVTAAIALENAVKEAMEVGRDVFMVGVSGSTENRLRKLKLLERLPEGHLTSD
RLSALRLAVAGLPAHG
NT seq 1671 nt   +upstreamnt  +downstreamnt
ttgacgctgggccggatcgtgctgaaccgcatcaacgccacaaacctgaagggggatgtg
ttcggcggactgacagctgccgtgatcgccttacccatggcattggccttcggcattgcc
tcgggtgccggcgctgctgccggtctctggggggcggtgatcatcggtctggtggcgtcg
ctgttcggcggcacgcccaccctgatttccgagcccacaggcccgatgaccgtggtgttc
acgtcagtgatcatcagtttcactgcgacagccgacagccctgagcaggccttggcgatg
gccttcagcgtcggcgttctggcagggatctttcagatcctgttcgggctgttccggctt
gggcgttacgtcacgatgatgccctacacggtgatttcgggcttcatgtccggcatcggc
atcatcctggtgctgctgcaactggggcccttcctgggacaggccactcccaaggggggg
gtgatgggcaccttgttggagatgccggccctggttcagggaacccagcccatggagctg
ctgctggccttgatcaccctggccatcctttggttcaccccctctgcggtgaaaaaggtc
tgcccgccgcagttgctggcacttgtggtgggcaccgtgctggctctgagcctgttcagt
ggcgccggcctgcgcaccattcctgagttttctgccgcattgcccagcttccagctgccg
acgttctccagcggtcagttgcggctcatggtgatcgatgctgctgtgctcgggatgctc
ggctgcattgatgcgctgctcacctcagtggttgccgacagcctgacccgcacggaacac
aactccaataaggagctgatcggccagggtctggccaatgttgtgtccgggctgtttggg
gcgatgcctggtgccggagccaccatgggaacggtggtcaacattcagtccggcggacga
accgccttgtcaggcattgtcagggccatggtgctgatgctggtggtgttgctggcggcc
ccgctggcatcccgcattcccctggcggtgctcgccggcatcgccgtgaaggtgggcatc
gacatcatggactgggattttctccagcgggcccaccatctttcggtgaaagctgcggtg
atcacctacggcgtgatcgctctcacggtgctggtggatctgatcgctgcagtgggtatc
ggcgtgtttgtcgccaacgtgctcacgatcgaccgcatgagcacgctgcagtccaagaag
gtgaaaaccatcagcaccaccgatgacgatgtggagctcagtgatgaggagcagcagctg
ctggatcgagcctccggcatggtgctgctgttccagttggctggcccgatgatttttggg
gtcgccaaggcgatctcccgcgagcacaacgccatcggcaattgccaggctgtggtgttt
gacctctccgaggtgtcccacctgggagtgaccgctgccatcgcccttgagaatgcagtg
aaagaagcgatggaggtgggccgcgatgtgttcatggttggtgtttctggaagcaccgag
aaccgccttcgcaaactgaagttgctagagcgcttgccggaggggcatctcacctctgat
cgcctgtcggctctgcgtctggcggttgcagggcttccagcccatggctga

DBGET integrated database retrieval system