KEGG   Synechococcus sp. WH8102: SYNW1629Help
Entry
SYNW1629          CDS       T00144                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syw01100  Metabolic pathways
syw01110  Biosynthesis of secondary metabolites
syw01130  Biosynthesis of antibiotics
syw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNW1629 (trpC)
Enzymes [BR:syw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SYNW1629 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh ThiG Aldolase
Motif
Other DBs
NCBI-ProteinID: CAE08144
CyanoBase: SYNW1629
CYORF: SYNW1629
UniProt: Q7TTU3
Position
complement(1566469..1567353)
Genome map
AA seq 294 aa AA seqDB search
MEIRRRPPNPKVRVAHLEYAVPHDEEEPKNILEKIVWAKDREVDAARERVPLQTLKRQIE
DLPPTRDFLAALREAPVQPAVIAEVKKASPSKGVIREDFDPVAIAEAYAAGGARCLSVLT
DKTFFQGGFDVLVEVRQAVDLPLLCKEFVLSPYQLFQARAAGADAVLLIAAILTDQDLQY
LKKAAAALGLDVLVEVHDAAELERVLNLGGFPLIGINNRDLTSFETDLSTTEQLMERFGD
RLQDQGSLLVSESGLFDRSDLDRVKAAGADAVLVGEALMRQQDVQSALTNLIHG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgtcgtcgtccccccaatccgaaggtgcgcgtggcgcatctggagtacgcc
gttccccacgacgaggaggaacccaagaacattctcgaaaagatcgtctgggccaaagac
cgtgaagtggatgccgcccgcgagcgggtgccgctgcagaccctcaaacggcagatcgag
gatctgccgccgacaagggacttcctcgctgccctgcgcgaggcccctgtgcagcctgcc
gtgatcgcggaagtgaagaaggcaagccccagcaagggggtgatccgggaggatttcgat
cctgtcgcgatcgccgaggcctacgccgccggcggtgcacgctgcctgtctgtgctcacc
gacaagaccttttttcagggcggcttcgacgtgctggtggaggtgcggcaggcggtggat
ctgcctctgctgtgcaaggaattcgtcctcagcccttatcagctgttccaggcccgcgcg
gccggtgctgatgccgtgctgctgattgcagcgatcctcacggatcaggatctgcagtac
ctgaagaaggccgctgccgctctgggtcttgatgtgctggtggaggtgcatgacgccgcc
gagctggagcgggtgctcaacctcgggggcttcccgttgattggcatcaacaaccgtgat
ctcaccagcttcgagacggatctatccaccaccgagcagctcatggaacgcttcggcgac
cgtcttcaggatcagggctcgttgctggtgagtgagtcaggcctctttgaccgttcagat
ctggaccgggtcaaggccgctggcgccgatgccgtgctggttggcgaagccttaatgcgt
caacaggatgttcagtcggccctgacaaacctgatccacggctga

DBGET integrated database retrieval system