KEGG   Synechococcus sp. WH8102: SYNW1704Help
Entry
SYNW1704          CDS       T00144                                 

Gene name
cobB
Definition
(GenBank) Cobyric acid synthase CobB
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00860  Porphyrin and chlorophyll metabolism
syw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNW1704 (cobB)
Enzymes [BR:syw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     SYNW1704 (cobB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: CAE08219
CyanoBase: SYNW1704
CYORF: SYNW1704
UniProt: Q7U5J9
Position
1637307..1638797
Genome map
AA seq 496 aa AA seqDB search
MNRKRPLMVLGTSSGAGKSLMTAALCRVLHRRGEQPLPFKGQNMSNNAWVDADGGEMAYS
QAMQAWAAGLEPCCAMNPVLLKPRGDSTSEVIHGGTSVGLARAEHYYRDWFRPGWQAIRE
GLQTMQQRWPNGRLVLEGAGSPVEVNLQRRDLTNLRLAQYLRANCLLVADIERGGVFAQI
VGTLALLRPVERPLIKGILINRFRGRRELFDEGRSWLEQHTGVPVLGVMPWLNDLFPPED
SLDLLERKPNRGPTDLEIAVLKLPSISNFSDLDPLEAEPSLRLRWVHPGDSLGSPDAVLL
PGSKQTLRDLETLRSSGLDRQLTAYATNGGSLLAICGGMQLLGQELHDPEQLEGGDGAGP
WPGLGLLPLTTEFGGTKALRQREVQALWPGTTPISGFELHHGSTWASDDLQPICNEPGLG
WWCATPAGGCIAGTYLHGLLDNGPWRRRWLNQLRERKGLAPLITGLPHHGEHRHQLLERL
ADAFEQHVDLTPLLQP
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgcaagcggccactgatggtgctggggacctccagtggagccggcaaatccctg
atgacagcagctctctgccgggtgctgcaccgccgcggcgaacaaccgctgcccttcaag
gggcagaacatgagcaacaacgcctgggtggatgccgacggcggcgagatggcgtactcc
caggcgatgcaggcctgggccgccggtctggagccctgctgtgccatgaatcccgtgctg
ctcaagccacggggcgatagcaccagtgaggtgatacacggcggcaccagcgttggcctg
gcccgagcggagcattactaccgcgactggttccgtcctggctggcaggcgatccgtgaa
gggctccagaccatgcaacagcgatggcccaacggtcggctggtgctggagggggccggc
agtccggtggaggtgaatctgcaacgacgggacctcaccaacttgcgcctggcccaatac
ctacgcgccaactgcctgctggtggcggatatcgaacgcggcggcgtgttcgcacagatc
gtcggcaccctggcgctgcttcgtccggtggaacggccgttgatcaaagggatcctgatc
aaccgcttccgtggccggcgtgaattgttcgatgaaggtcgcagttggctggaacagcac
accggtgttccggtgctcggggtgatgccgtggctcaacgatctgtttccgccggaggac
tccctcgatctgctggagcgcaagcccaaccgaggacccaccgatctggagatcgcggtg
ctgaagctgccgtcgatcagcaacttctcggatctcgacccgctggaggcggaacccagc
ctgcggctgcgctgggtgcaccctggcgacagccttggaagccccgatgctgtgctgctg
cctggcagcaaacagacactgcgggatctcgagactttgcgcagcagcgggctggaccgt
cagctcacggcctatgccaccaatggaggctcactgctggcgatctgcggtggcatgcag
ctgctcggacaggagctgcacgaccctgagcaactggagggcggtgatggggctgggccc
tggcccgggctggggttgttaccgctcactacagagttcggtggaacgaaggccttgcga
caacgtgaggttcaagcgctctggccggggacaactccgatctccggctttgaactgcac
cacggcagcacctgggcttctgatgatctccagccaatctgcaacgagccgggtctcggc
tggtggtgcgcaacaccggctggtggctgcatcgccggcacctacctgcacggacttctc
gacaacggtccctggcggcgtcgttggctcaatcagctgcgcgaacgcaaggggctggcg
cccctgatcaccggcctgccccaccacggggagcaccgccaccaactgctcgagcgcctg
gccgatgccttcgagcagcatgtggatctaacaccactgttgcagccgtga

DBGET integrated database retrieval system