KEGG   Synechococcus sp. WH8102: SYNW1809Help
Entry
SYNW1809          CDS       T00144                                 

Gene name
hemL,gsa
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00860  Porphyrin and chlorophyll metabolism
syw01100  Metabolic pathways
syw01110  Biosynthesis of secondary metabolites
syw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNW1809 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:syw01007]
    SYNW1809 (hemL)
Enzymes [BR:syw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     SYNW1809 (hemL)
Amino acid related enzymes [BR:syw01007]
 Aminotransferase (transaminase)
  Class III
   SYNW1809 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 AIRS
Motif
Other DBs
NCBI-ProteinID: CAE08324
CyanoBase: SYNW1809
CYORF: SYNW1809
UniProt: Q7U598
Position
1735513..1736799
Genome map
AA seq 428 aa AA seqDB search
MNTSRSQAIFGAAQGLMPGGVSSPVRAFKSVGGQPIVFDRVKGPYAWDVDGNKYIDYIGS
WGPAICGHAHPEVISALQEAIEKGTSFGAPCALENTLAEMVIDAVPSVEMVRFVNSGTEA
CMAVLRLMRAFTGRDKVIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPRSTTANTLT
APYNDLEAVKALFAENPDAIAGVILEPIVGNAGFIQPEPGFLEGLRELTKEHGALLVFDE
VMTGFRISYGGAQAHFGVTPDLTTMGKVIGGGLPVGAYGGRADIMGMVAPAGPMYQAGTL
SGNPLAMTAGIKTLELLKQPGSYEKLTATTEKLIAGIKEAATAAGLPFTGGSVSAMFGFF
LCEGPVRNFEDAKATDSERFGKLHRAMLERGVYLAPSAFEAGFTSLAHSEADIEATVNAF
RESFAEVA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaccagccgctcccaggccatcttcggcgcagcgcaggggctgatgcccggtggc
gtgagctcccctgtacgggcgttcaagtcggttggcggccagccgatcgtgttcgaccgg
gtgaagggtccctacgcctgggatgtcgacggcaataaatacatcgactacatcggcagc
tggggcccggccatctgcggccatgcccatcccgaggtgatcagcgccctgcaagaggcg
atcgaaaagggcaccagcttcggcgccccctgcgctctcgagaacactctggccgagatg
gtgatcgacgccgtccccagtgtggagatggtgcgcttcgtcaacagcggcaccgaggct
tgcatggcagtgctgcgcctgatgcgagccttcaccggtcgcgacaaggtgatcaagttc
gagggctgttatcacggccatgcggatatgttcttggtgaaggcaggctccggggtggcc
accctcggcctcccggattctcctggcgttccgcggagcaccaccgccaacacgctcacg
gcgccttacaacgatctggaggccgtcaaagcgctgttcgccgagaaccctgatgccatt
gccggcgtgattctcgaacccatcgtcggcaacgccggattcatacagcctgagcctggg
ttcttggaaggcctgcgggaactcaccaaggaacatggcgcgctgctggtgttcgatgag
gtgatgacgggcttccgcatcagttatggcggcgcccaggcccacttcggcgtcacgccg
gatctcaccacgatgggcaaggtgatcggtggcggcctgcccgtgggtgcctacggcggc
cgcgccgacatcatgggcatggtggctccagcagggccgatgtatcaggccggcacactc
agcggtaacccactggcgatgaccgctggcatcaaaacgctggaactgctgaaacagccc
ggcagttacgagaaactcaccgcgacgaccgaaaaactgatcgcgggcatcaaggaggcg
gctacagcggctggacttcccttcacgggtggcagtgtcagcgccatgttcggatttttc
ctatgtgaaggccctgttcgcaacttcgaagacgccaaagccaccgattccgaacggttt
ggcaaactgcatcgcgccatgctcgagcggggcgtgtatctggccccatcggcctttgag
gcgggattcacctccctggcccactccgaagcagacattgaggccaccgttaatgctttc
cgcgagagcttcgcggaggtggcctga

DBGET integrated database retrieval system