KEGG   Synechococcus sp. WH7803: SynWH7803_0151Help
Entry
SynWH7803_0151    CDS       T00524                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00480  Glutathione metabolism
syx00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SynWH7803_0151
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SynWH7803_0151
Enzymes [BR:syx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SynWH7803_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CAK22577
CyanoBase: SynWH7803_0151
CYORF: SynWH7803_0151
UniProt: A5GI12
Position
complement(167912..168391)
Genome map
AA seq 159 aa AA seqDB search
MAPSVSNVSVRTPDGSEKTLGSYAGQVLLIVNVASRCGFTKQYAGLQSLQDTFGPRGLQV
LGFPCNDFGAQEPGTLDEIKSFCSTTYGASFELFDKVHATGSTTEPYTTLNQTEPAGAVE
WNFEKFLVGKDGTVLARFKSGVAPEDAGLNAAIEAALQA
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctcccagcgtcagcaacgtgtccgtccgcacccccgacggcagtgaaaaaaccctc
ggcagctatgcaggccaggtgctgctgatcgtgaatgtggccagccgctgcggattcacc
aagcagtacgccggtctgcagagcctgcaggacaccttcggcccccgcggcctgcaggtg
ctgggtttcccctgcaacgacttcggcgcccaggagcccggcaccctggatgaaatcaag
agcttctgctccaccacctacggcgccagcttcgagctgttcgacaaggtgcacgccacc
ggcagcaccactgagccctacaccaccctcaaccaaaccgagccggccggtgcagtggag
tggaatttcgagaagttcctggtgggcaaggacggcaccgtgctggcccgcttcaagagt
ggtgtggctcctgaagacgccggactcaacgcggcgattgaggccgctctgcaggcctga

DBGET integrated database retrieval system