KEGG   Synechococcus sp. WH7803: SynWH7803_0866Help
Entry
SynWH7803_0866    CDS       T00524                                 

Gene name
ggt
Definition
(GenBank) Gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00430  Taurine and hypotaurine metabolism
syx00460  Cyanoamino acid metabolism
syx00480  Glutathione metabolism
syx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SynWH7803_0866 (ggt)
   00460 Cyanoamino acid metabolism
    SynWH7803_0866 (ggt)
   00480 Glutathione metabolism
    SynWH7803_0866 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:syx01002]
    SynWH7803_0866 (ggt)
Enzymes [BR:syx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     SynWH7803_0866 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     SynWH7803_0866 (ggt)
Peptidases and inhibitors [BR:syx01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   SynWH7803_0866 (ggt)
CD molecules [BR:syx04090]
 Proteins
  SynWH7803_0866 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: CAK23292
CyanoBase: SynWH7803_0866
CYORF: SynWH7803_0866
UniProt: A5GK27
Position
complement(821141..822976)
Genome map
AA seq 611 aa AA seqDB search
MVRSCNRSLPTTLSSAGARLGWSLFRSRPTLMIGALLLLLSLSPVSAAPVSRDDPEQADT
RKSRISTAAGSAVVVTANPLASKAALNVLASGGHAVDALVAAQAVLAVAEPQSSGLGGGG
FLLHWDARRQALEVFDGRETAPERSRSDDLLKPSGDPLSYRAATRNPDAIGIPGTVALLW
EAHQQMGQRPWSSTLQPAIRLAREGFLPSPRLRSSVALAQRLGATHNLAFQQLYLPGGKP
LPAGRLFRNPALARTLETLAQHGGRAFYEGPLAQRIQSGVNALTAQAPNFKGWSANDLAS
YAVVRRSPLCRVLMKHRVCTVPPPSSGGLAVLQTLALLEATGGFNDPDNPQSWRDLALAE
SWADADRLYWVHDPIDGSVPTQGLLNPSYVQARAQAMQASPGRLPQPGLPPGLKRFPFGR
PGPGPELGTSHVTIVDGAGNIASYTTTVETVFGSRNLVEGMVMNNQLTDFDWRPVVGGLA
VANRRRPGRRPVSSMAPTIVFNNQQPVLALGSPGGKRIPHFISRVLLAALQWAEPPKRSV
GLPLLSPQGDSLVIEKDPPLPWPINPNQLNVPGRKLRSQTLGSGIGLLQRIGDRWHGAAD
PRREGTALALP
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggtccgctcctgcaaccgatccctgcccaccacgctaagcagtgccggcgccagactc
ggctggagcttgttccgatcccgccccaccttgatgattggcgccctgctgttattgctc
tcgctcagccccgtgagcgcagctccggtgagtcgcgatgatcccgagcaggcggacacc
cgaaaatcccgtatttccacggctgccggttcggccgtggtcgtcaccgccaaccccctg
gccagcaaggccgctctcaatgttcttgccagcgggggccatgccgtggatgccctggtg
gcagcgcaggcggtgctggccgtggccgaaccgcagagttccgggctcggaggcggaggt
ttcctcttgcactgggatgcccgtcgccaggcactggaggtgttcgatggccgtgaaacc
gcacccgagcgcagccgcagcgacgacctgctcaagccctccggtgacccactgtcctat
cgggcggccacccgcaatccggatgcgatcggcattcctggcaccgtggccctgctctgg
gaggcccatcaacagatggggcagcggccctggtccagcacccttcagcccgccatccgc
ctggcccgcgaaggcttcctgcccagcccgcggctgcgcagctccgtggccctggcccag
cgcctcggcgcaacccacaacctggccttccaacagctgtatctgcctggcggcaagccg
ttgccagccggccgtctgttccgcaacccagccctggcccgcaccctggagaccctggcg
cagcatggtgggcgcgccttttacgagggcccgctggcccaacggatccagagcggggtg
aacgccctgacggctcaggcccccaacttcaagggctggagcgccaatgatcttgcctcc
tacgccgtggtgcgccgatcccccctttgccgggtgctgatgaagcaccgcgtctgcacg
gtgcccccgccaagcagcggcggcctggcggtgctgcagaccttggccctgctcgaggcg
accggcggcttcaacgatccagacaatccacagagctggcgcgatctggccctggcggaa
tcctgggccgatgccgatcgcctctactgggtgcacgatccgattgatggctctgttccc
acccagggactgctgaatccgagttatgtgcaggcccgtgcccaggccatgcaggcctca
cccggacgcctgccgcagcccggtctgcccccaggattgaagcggttccccttcggtcgc
cctgggcccggcccggagctgggcacctcccacgtcacgatcgtggacggtgcaggcaac
atcgccagttacaccacaacggtggaaaccgtgttcggcagtcgcaatctggtggagggc
atggtgatgaacaaccagctcaccgacttcgactggcgacccgtggtcggggggctcgcc
gtagccaaccgccgccggccagggcgccggccagtgtcgtcgatggcgccaacgatcgtc
ttcaacaaccagcaaccggtcctggccctgggcagcccggggggaaagcggatcccgcac
ttcatcagccgggtgctgctggccgcactgcaatgggcggaacctccgaagcgatcggtg
ggcctgcccctgctgtccccccagggagacagcctcgtgatcgaaaaggacccaccgctt
ccctggcccatcaatcccaatcaactcaacgtccccgggcgcaagttgcgctcccagacc
ctgggcagcggcatcggcttgctgcaacgcatcggcgaccgctggcatggagccgccgac
cctcggcgggaaggaacagccctggccctgccctga

DBGET integrated database retrieval system