KEGG   Synechococcus sp. WH7803: SynWH7803_1040Help
Entry
SynWH7803_1040    CDS       T00524                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00010  Glycolysis / Gluconeogenesis
syx00620  Pyruvate metabolism
syx00640  Propanoate metabolism
syx00680  Methane metabolism
syx01100  Metabolic pathways
syx01110  Biosynthesis of secondary metabolites
syx01120  Microbial metabolism in diverse environments
syx01130  Biosynthesis of antibiotics
syx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynWH7803_1040 (acsA)
   00620 Pyruvate metabolism
    SynWH7803_1040 (acsA)
   00640 Propanoate metabolism
    SynWH7803_1040 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SynWH7803_1040 (acsA)
Enzymes [BR:syx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SynWH7803_1040 (acsA)
Lipid biosynthesis proteins [BR:syx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SynWH7803_1040 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAK23466
CyanoBase: SynWH7803_1040
CYORF: SynWH7803_1040
UniProt: A5GKK1
Position
955956..957926
Genome map
AA seq 656 aa AA seqDB search
MSEGSTIESVLKEQRVFAPPIELTQSARIGGMEAYQAMADAARKDPDAFWGDAARRELDW
FTPFEQVLDWSNPPFARWFQGGTTNLSHNCLDRHLHGETANKTALIWEGEPGDVRRFTYR
ELHAEVCKAANALKSMGIGKGDLVALYMPMIPEAAIAMLACARIGAPHSVVFGGFSAEAL
RDRLIDGEAKAVITADGGFRKDKPVSLKPAVDAALAGGACPSVTSVLVVQRTQQPVEMAQ
GRDQWWHALVDGQSSECPAEPMQSEDRLFVLYTSGSTGKPKGVVHTTAGYNLWAHLTFQW
IFDLRDNDVYWCTADVGWITGHSYIVYGPLSNGATTVMYEGAPRPSKPGAFWEVIQKHGV
TIFYTAPTAIRAFMKSGRTVPDQFDMSSLRLLGTVGEPINPEAWMWYRDVIGGGRCPIID
TWWQTETGGVMISPLPGATPTKPGSATLPLPGIEADVVDAEGNSVAANEGGYLVVRRPWP
GMMRTVHGNPERFRQSYWEHIRPDDGSHIYFAGDGARRDADGYFWVMGRVDDVINVSGHR
LGTMEIESALVSHPAVAEAAVVGRPDDLKGEGIVAFVTLEVEREASDALIAELRAHVGTE
IGPIARPDEIRCSDALPKTRSGKIMRRILRALAAGEDVTGDTSTLEDRSVLDRLRA
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaggttccacgatcgaaagcgtgctcaaggagcagcgcgtttttgctccgccc
attgagctcacccagtcagcccggatcggtggcatggaggcctaccaggccatggccgat
gcagccaggaaggatccagacgcgttctggggtgatgcggctcgtcgggaactcgactgg
ttcacaccgtttgagcaggtgctcgactggtccaatcctcccttcgctcgctggtttcaa
gggggcaccaccaacctttcgcacaactgccttgatcgccatcttcacggtgagacggcc
aacaagacggccctgatctgggaaggggagcccggcgatgtccgccgcttcacctaccga
gaactgcacgctgaggtgtgcaaggcggccaatgcgctcaaatccatgggcattggcaaa
ggggatctggtggccctctacatgccgatgattccggaggcggcgattgccatgctggcc
tgtgcccgcatcggcgctccccactcagtggtctttggtggcttctccgcagaagcgctt
cgagaccgcctgatcgatggagaggcgaaggccgtgatcacggctgacggtggcttccgc
aaggacaagcccgtttcactgaaacctgccgtcgatgccgccctggccggcggtgcctgt
ccatcggtgacctccgtgctggtggtgcagcgcacccaacagccggtggagatggcccag
ggccgcgaccagtggtggcatgcgctcgtggatggccagtccagcgaatgcccagcggag
ccgatgcagagcgaagatcggctcttcgtgctttacacgtctggatccactggcaaaccc
aagggggtggtgcacaccaccgcgggatacaacctctgggcccacctcacgtttcagtgg
atctttgatctccgcgacaacgacgtgtactggtgcacagcggatgtgggctggatcacc
ggtcacagctacatcgtgtatggcccgttgtcgaacggggccaccacagtgatgtacgag
ggtgcgccacgaccttcgaagcctggggcgttctgggaggtgatccagaagcacggggtc
acaatcttctacaccgctcccacagcgatccgggcgttcatgaagagcggccgaaccgtg
ccggatcagttcgacatgagcagcttgcgattgctcggaaccgtcggtgaacccatcaac
cctgaagcctggatgtggtacagggatgtgatcggtggtggccgctgtccgattattgac
acctggtggcagaccgaaaccggcggcgtgatgatcagccctcttcctggggccaccccg
accaagcctggctcagccaccctcccgcttcctggaatcgaagccgatgtggtggacgct
gaaggcaacagtgtggcggccaatgaggggggatatctggtggtgcgtcgtccctggccc
gggatgatgcgtacggtgcatggcaatccagagcgattccgtcagagctactgggagcac
atccgtccagacgatggcagccacatctacttcgctggtgacggtgcgcgtcgcgatgcg
gacggttacttctgggtgatgggacgcgtggacgacgtcatcaatgtgtcgggccaccgt
ctcggcaccatggaaatcgaatcagccctggtcagtcaccctgcggtggcggaggccgct
gtggtcgggcgtcctgacgatctcaaaggcgagggcattgtggccttcgtcacccttgag
gtggagcgcgaagccagtgatgcactgatcgctgaattgcgggctcatgtgggaaccgaa
atcggcccgatcgctcgccctgatgaaatccgctgcagtgatgcccttcccaaaacgcgc
agtggcaagatcatgcgccggattctcagggcactggcagctggggaggatgtgactggt
gacaccagcaccctggaagatcgctccgtgctggatcgtttaagggcctga

DBGET integrated database retrieval system