KEGG   Synechococcus sp. WH7803: SynWH7803_1154Help
Entry
SynWH7803_1154    CDS       T00524                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00330  Arginine and proline metabolism
syx00332  Carbapenem biosynthesis
syx01100  Metabolic pathways
syx01130  Biosynthesis of antibiotics
syx01230  Biosynthesis of amino acids
Module
syx_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SynWH7803_1154 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SynWH7803_1154 (proB)
Enzymes [BR:syx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SynWH7803_1154 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAK23580
CyanoBase: SynWH7803_1154
CYORF: SynWH7803_1154
UniProt: A5GKW5
Position
complement(1055248..1056363)
Genome map
AA seq 371 aa AA seqDB search
MMLRVVKVGTSLLRERPNATTGDAIARLANSLAESIHNGDQVVLVTSGAVGLGCQRLGMP
HRPTSVSGLQAAAAIGQGHLMSLYEKALAQRSVPVAQVLLTRSDLADRRSYHNASATLHQ
LLQWGVLPVVNENDTVSSAELRFGDNDTLSALVAAAVGADELILLTDVDRLYTADPRSDS
AATPITDVLHPSEIAELEEGAGDGGRWGTGGMTTKLAAARIATASGITVHLGDGRNPEGL
RQILQGGRGGTVFHPHPEPLGNRKSWLVHALQPTGSLSIDSGACRAVRQRGASLLLVGIT
AVEGQFSANQAVRVLDPDGQEIARGLTSMDSEQLAFRLNQTSKPGTLGGSPVVIHRDAMV
LITPTIRQPAS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcagggttgtgaaggtcggcaccagcctgctccgggaacgtccgaatgccaca
acgggagatgcgatcgcacgtctggccaacagcctggcggagagcattcacaacggggac
caggtggttcttgtgacctccggggccgtggggctgggctgtcaacgcctggggatgccc
caccgacccacgagcgtttctggcctgcaagccgctgcagccatcggccaaggccatctg
atgagcctctacgagaaagccttagcgcaacgctcggttccggtggcccaggtgctcttg
acgcgctcagatctcgctgatcgccggagttaccacaacgcctcggcaaccctgcaccaa
ctgctccagtggggtgtactgccggtggtgaatgagaacgacacggtgtcatcagccgag
ctgcgcttcggcgacaacgacaccttgtcggcgctcgtggctgcggccgtgggtgccgat
gaattgattctgctcacggatgtggaccgcctctacaccgctgacccccgcagtgacagc
gcagccactccgatcaccgatgtgctgcatccctcggaaatcgccgagctggaggagggc
gccggggacggcggccgctggggaaccggtgggatgaccaccaaactggcagcggcacgc
atcgctacggccagcggcatcaccgtgcatctcggcgacggacgcaaccccgagggactg
cggcagatcctccagggggggcggggtggcacggtcttccatccccaccccgaaccgctg
ggcaaccgcaaaagctggttggtccatgccctccagcccacaggaagtctgtccatcgac
agtggtgcctgcagggccgtgagacaacgcggtgcctccctgcttctggtgggaatcacc
gctgttgagggtcagttcagcgccaatcaggccgtgcgcgtgctcgaccccgatggccag
gagatcgcccgtgggctgacatccatggacagtgagcaactcgcgtttcgcctgaaccaa
acctccaaacccggcacccttggaggctcccccgtggtgattcaccgtgacgccatggtg
ctgatcacccctacgatccgccagccagcctcctga

DBGET integrated database retrieval system