KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_0296Help
Entry
SYNGTS_0296       CDS       T02098                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00260  Glycine, serine and threonine metabolism
syy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
syy01130  Biosynthesis of antibiotics
syy01230  Biosynthesis of amino acids
Module
syy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNGTS_0296 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNGTS_0296 (trpA)
Enzymes [BR:syy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SYNGTS_0296 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth ThiG NanE TMP-TENI FMN_dh IGPS
Motif
Other DBs
NCBI-ProteinID: BAK49044
Position
326150..326944
Genome map
AA seq 264 aa AA seqDB search
MNAVAACFNALRQRGECALIPFLTAGDPDLATTAEALRILDRAGADLIELGVPYSDPLAD
GPVIQAAATRALQKGVKLDDVLAIVREVHQDIAAPIILFTYYNPIFYQGVEVFLDKIKAA
GVKGLVVPDLPLEESDRLLEATAERGLELILLVAPTSSPERQTAIAKKSQGFVYLVSVTG
VTGVRTEVGSRVEALLAGMRQVTDKPIGVGFGISQPEQAEQVKAWGADAVIVGSAMVKRL
AEGTPTEGLQALETFCRELKTAIS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgttgccgcttgttttaatgcccttcgtcaacggggggaatgtgctttgatt
cctttcctcacagcgggggacccggatttagccaccacagccgaagcgttgcgaattcta
gaccgggcaggggcggatttaattgagttgggagtgccctattccgatcctttggccgat
ggcccggtgattcaagcggcggccactagggctttacaaaaaggggtcaagttggatgat
gtgctcgccattgtccgagaagttcaccaagatattgccgccccgataattttatttacc
tattacaatcctattttttatcagggtgtggaggttttcctcgacaaaatcaaggccgct
ggagtgaagggtttggtggtgccggatttacccctggaggaatctgatcgcctgttggaa
gcgacagcggaaagggggttggagttaattttgttggtggcccccaccagttccccagaa
agacaaacggcgatcgccaaaaagtcccagggctttgtttacttggtcagcgtgacaggg
gtgacgggggtgagaacggaagtgggatcgagggtggaagctttgttagcagggatgcgc
caggtcaccgataaaccgattggagttggttttggtatttcccaaccggaacaggctgag
caggtgaaagcttggggcgcagatgcagtaattgtaggaagcgccatggttaagcgttta
gcggaaggaaccccgacggaaggattgcaagctttggaaactttttgccgggaactgaaa
acggccatcagttaa

DBGET integrated database retrieval system