KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_0591Help
Entry
SYNGTS_0591       CDS       T02098                                 

Gene name
chlI
Definition
(GenBank) Mg chelatase subunit
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00860  Porphyrin and chlorophyll metabolism
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNGTS_0591 (chlI)
Enzymes [BR:syy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SYNGTS_0591 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 MCM AAA_16 Sigma54_activat AAA_29 AAA ABC_tran DUF815 AAA_18 AAA_28 tRNA_lig_kinase AAA_30 MMR_HSR1 FtsK_SpoIIIE AAA_27 RNA_helicase AAA_7
Motif
Other DBs
NCBI-ProteinID: BAK49339
Position
658262..659335
Genome map
AA seq 357 aa AA seqDB search
MTATLAAPSKTRRVVFPFTAIVGQDEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIEVVANDPFNSSPSDPEMMSEEVRIRVDSQEPLSIVKKKVTMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAAGGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVREPELRVKIVEQRTEFDQNP
HPFCDQYQTEQEALQAKIVNAQNLLPQVTIDYDYRVKVSEVCAELDVDGLRGDIVTNRAA
KALAAFEGRTEVTVDDISRVIVLCLRHRLRKDPLESIDSGSKVEKVFKRVFGVVDEA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgactgccacccttgccgcccccagcaaaacccgccgtgttgtttttccttttacggcg
atcgtcggtcaagatgaaatgaagttggccctgttgctcaatgtcattgatcccaagatt
ggcggcgtcatgatcatgggcgatcggggaaccgggaaatccactaccattagagctttg
gcggatttgttgccggaaattgaggtggtggccaatgatccttttaactcttcccccagc
gatcccgagatgatgagtgaggaagtacggatccgggtagatagccaagaacctttatct
attgtcaaaaagaaagtcaccatggtggatttgcccctgggggcaacggaagaccgggtg
tgcggcaccatcgacatcgaaaaggcattatcagaaggagttaaagcctttgaaccgggt
ttattggccaaagccaaccggggcattctctatgtggacgaagttaacctgttggacgat
cacttagtggacgtgttgttggactccgctgctgggggttggaacacggtggagcgggaa
ggtatttccattcgccatccggcccggtttgttttagtgggttccggtaacccagaagaa
ggggaattgcggcctcaattgttggatcgattcggcatgcatgctgaaattcgcactgtg
cgggaaccggaattgcgggtaaaaattgtcgaacaacggacggagtttgaccaaaatccc
catcctttctgtgaccaatatcaaacggaacaggaagcgttacaagcaaaaattgttaat
gcccagaatttactgccccaagtgaccattgactacgactatcgggtgaaagtatcggaa
gtctgtgcagaacttgatgtggacgggttacggggagatattgttaccaatcgggccgcc
aaagccctggccgcttttgaaggtcgcactgaggtaacagtggatgatattagccgagta
attgtgctttgtttacgccatcgtttacggaaagatcctctagagtccattgattccggc
agtaaggtggaaaaggtatttaaacgggtttttggcgttgtcgatgaagcttaa

DBGET integrated database retrieval system