KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2216Help
Entry
SYNGTS_2216       CDS       T02098                                 

Gene name
sll0021
Definition
(GenBank) hypothetical protein
  KO
K03547  DNA repair protein SbcD/Mre11
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
KEGG Orthology (KO) [BR:syy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:syy03400]
    SYNGTS_2216 (sll0021)
DNA repair and recombination proteins [BR:syy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SYNGTS_2216 (sll0021)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: BAK50964
Position
complement(2463892..2465142)
Genome map
AA seq 416 aa AA seqDB search
MLKVLHLSDIHLGSGFSHGHINPATGLNTRLEDFIQSLRLCIDRAIAEPADVVLFGGDAF
PDATPPPYVQEAFAAEFRRLADADIPTVLLVGNHDQHSQGSGGASLCIYRTLAVPGFIVG
DRLATHLIPTANGDLQIVTLPWLTRSTLLTRPETEGLSLEAINLLLLKKLQPILEGEIRS
LDPQLPTILLAHLMADRATFGAEKTLSVGKGFTIPLALINRPEFDYVALGHVHKHQNLNP
HNNPPIVYPGSIERVDFGEEKEDKGYIWLEISKGKVDWQFCPLPARPFKTIKVDVTEATD
PQGELLMAIAKTAIDNAVVRLIYQIRSEQLEQIDNRKLQEALKPSHSYTIRPELVSQLAR
PRLPELGVGSALDPLVALKTYLENKKDIKELMPDLMEAAEHLLNGSEEQWLEAVGD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagtcctgcatctttctgatattcacctgggcagtggtttttcccatgggcac
attaatccggccacggggttaaatacgaggttagaggatttcattcagagtttacggctg
tgcattgaccgggcgatcgccgaacccgccgatgtggtgctatttgggggggatgctttc
cccgatgccactccgcccccctatgtgcaggaagcctttgccgccgaatttcgccgttta
gccgatgccgatattcccacagtgttattggtgggcaaccatgaccaacattcccagggc
agtggaggagctagtttatgtatctatcgcaccctggctgtgcccggtttcatcgttggg
gatcgcctggccacccatttaattcccaccgccaatggagatctacagattgttaccttg
ccttggttaacccgttcgactctcctaacccggccggaaacggaggggttatccttggaa
gcgattaatttgctgttgctgaaaaagttacagcccattttggaaggggaaattcggagt
ttagatccccaattacccactattttgttggcccatttaatggcggaccgggccaccttt
ggggcggaaaaaaccctgtccgtgggcaagggctttaccattcccctggctttgattaat
cggccggaatttgattacgttgccctgggccatgtccataaacatcaaaatctcaatccc
cacaataatccccccattgtttatcccggtagcattgagcgggtggactttggcgaagaa
aaggaagacaaaggctatatttggctagaaattagtaaaggaaaagtagattggcaattc
tgtcccctgcccgctcgcccctttaaaaccattaaagtagatgtgacggaagcgacggat
ccccaaggggaattattaatggcgatcgccaaaacagccattgacaatgccgtggtgcgg
ctaatttaccaaattcgttctgaacagctagaacaaatcgataaccgcaaattacaggag
gctttaaagccgagccattcctacaccatccgtccagaactggttagccagttggcccgg
ccacggttgccagaattgggagtaggttccgcccttgatcccctggtggccctcaaaacc
tatctggaaaataaaaaagacattaaagagttaatgcccgacctcatggaagcagccgag
catttacttaatggcagtgaagaacaatggttagaagcggtgggggattga

DBGET integrated database retrieval system