KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2243Help
Entry
SYNGTS_2243       CDS       T02098                                 

Gene name
sppA
Definition
(GenBank) protease IV
  KO
K04773  protease IV [EC:3.4.21.-]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
KEGG Orthology (KO) [BR:syy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:syy01002]
    SYNGTS_2243 (sppA)
Enzymes [BR:syy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     SYNGTS_2243 (sppA)
Peptidases [BR:syy01002]
 Serine Peptidases
  Family S49: protease IV family
   SYNGTS_2243 (sppA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S49 CLP_protease SDH_sah RHH_3 Oxidored_q6
Motif
Other DBs
NCBI-ProteinID: BAK50991
Position
2499138..2499971
Genome map
AA seq 277 aa AA seqDB search
MIWPFKTSTRKKIARIEVTGAIASGTRKAVLKALKTVEEKKYPALLVRIDSPGGTVVDSQ
EIYTKLKQLSEKIKVVASFGNISASGGVYIAMGCPHIMANSGTITGSIGVILRGNNLERL
LEKVGVSFKVIKSGPYKDILSFDRELLPEEQSILQALIDDSYGQFVSTVAAGRNLAVEKV
KEFADGRIFTGQQALELGLVDRLGTEEDARQWAATLAGLDPDKVELDTIEDPKPLVRRLT
GGDSQLQTMADNLGLTESLKWCEFELSTSGQPLWLYR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgatttggcccttcaaaaccagcacccgtaaaaagattgcccgcattgaagtgaccggg
gcgatcgccagtggaacccgcaaagcagtattgaaggctctaaagacggtggaagaaaaa
aaatatcccgccctattggtccgcatcgattcccctgggggcacagtggtggattcccag
gaaatttacactaaattgaagcaattaagcgaaaagatcaaagttgtggccagttttggt
aacatttctgcttctggaggtgtgtacattgccatgggttgtccccacatcatggcgaac
tctggcaccatcaccggcagtattggcgtaattttacggggcaataacctggaaagatta
ctagagaaagtgggagtttcttttaaagtgattaaatccgggccctacaaagacattttg
tcctttgaccgggaattgctgccggaggaacagtctattttgcaggctttgattgacgac
agctacgggcaatttgtctccacggtggcggcggggcgcaatttggcagtggaaaaagtc
aaagaatttgccgacggaagaattttcaccgggcaacaggctctggaattgggtttagtc
gatcgcctgggcacggaggaagatgcaaggcaatgggccgctactttggcgggcttggat
ccagacaaagtagaactggataccattgaagaccccaaacctttagtcagaagactcacc
ggtggtgatagtcaactacagaccatggccgataaccttggtttgacggaaagcctaaaa
tggtgcgagtttgagctttccaccagtggtcaacccctctggctttatcgatga

DBGET integrated database retrieval system