KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2244Help
Entry
SYNGTS_2244       CDS       T02098                                 

Gene name
ponA
Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00550  Peptidoglycan biosynthesis
syy01100  Metabolic pathways
syy01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:syy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SYNGTS_2244 (ponA)
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    SYNGTS_2244 (ponA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:syy01003]
    SYNGTS_2244 (ponA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syy01011]
    SYNGTS_2244 (ponA)
Enzymes [BR:syy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SYNGTS_2244 (ponA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SYNGTS_2244 (ponA)
Glycosyltransferases [BR:syy01003]
 Polysaccharide
  Bacterial polysaccharide
   SYNGTS_2244 (ponA)
Peptidoglycan biosynthesis and degradation proteins [BR:syy01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   SYNGTS_2244 (ponA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: BAK50992
Position
complement(2500037..2502694)
Genome map
AA seq 885 aa AA seqDB search
MFKSFSRKLKRSTVNFLHQLANTLEVEEEVKSSAIEEKTLPVAQVAQHLESEAQNSVDGD
DGLIFPGDGDAAELEPGYGRGREMVTAINIQNVQHHSSANGAAAAEQNKSNGNGSEPGAS
TVTAEQVTSVPLSSADNTLERGSRRRRRRKRGKHKQSAPKTPLALVTGLKNVGRSVSQLT
QQPRFWLVFGFGLGAGMGTSALAWGFYQLETMTQVAIADVVTYAPRGTMTIKAANGAILQ
EIGNVSHDKVTMGEIPPLVEQAFVASEDSRFREHRGIDLQGIMRASLSNVQSGGVMQGGS
TITQQLARLVFLTQDRTLARKLKEVRLAQKIETALPKDQILERYLNLIYLGSGAYGVADA
AHAYFSKTPEELTLGEAATLAGVVPAPSVYSPRQNLELATRRRNEVLNRMAEVGFITPAE
AQAAIAEPLVINPSPLKRFNREAEFFADYILDELRAKLPEEELQQGGLTVNTTLNQQWQE
EAQTVLSDAVKRYGRWQRFSEGAMVAMDPRTGAIKMMVGGKDYDASQFNRVTQAKRQPGS
TFKPILYGAAIASGISPNKSYLNVPIDIGGYQPANYGDRYTGGNMSLTDALTSSVNVVAV
RLLLDVGWNPVINLARQMGITSKLEPTYSLALGAWEMTPLEMTSAYGTFANKGTHVQPYA
IQNVVNAQGEVVYKAEHKQTQALDPESNAILTSMMRRVVTSGTGRPAQLGDRQVAGKTGT
SDEAKDLWFIGYIPQLVTGVWLGNDNSRPTNGASTTAAMVWGQFMRDATKGMPVQSFPAL
PKNLDQRKPSIKAEPIKRRVKTLAPPSSPETDGQNTTERPRRHRRTQTDAARPSNIQTAR
TSAPASAPSAPPRAVSAPAPVAAPAAAPADANAGLPAPPAARKSE
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaatccttctcccgcaaacttaagcgctctaccgtcaactttctccaccagtta
gcgaacacattggaagtggaggaagaggttaaatcttcggcgatcgaggaaaagactctc
cccgttgcacaggttgcacaacatcttgagtctgaagcgcaaaattctgtcgatggcgat
gatgggttaattttccctggggatggcgatgccgccgaactggaaccgggttatggcagg
ggcagggaaatggttacagccattaatattcaaaacgttcaacaccatagctcagccaat
ggagcagcagcagcggagcaaaacaaaagcaatggtaatggtagtgaacctggggcatct
accgtcactgctgagcaagttacgtccgttcccctatcctctgccgacaatacattggag
agggggagccgccgccgtcgccgccgcaaaaggggtaaacataaacagtctgcgcccaaa
acgccccttgctttggtcaccggactaaaaaacgttgggcgatcggtttcccaattaact
caacagcctcgattttggttggtatttggttttggcttgggggccggcatgggaacttcc
gctttggcctggggcttttaccagttggaaaccatgacccaggtggcgatcgccgatgtg
gtcacctatgcccctaggggaaccatgaccatcaaggcggccaatggggccattctccag
gaaattggtaatgtcagccacgataaagtcaccatgggggaaattccgcccctagtggag
caggcattcgttgccagtgaagatagtcgcttccgggaacaccggggcattgatctccag
ggcattatgcgggcgtccctgtccaatgtgcaatccgggggcgtaatgcaaggaggcagt
accattacccaacagttagcccgcctcgtgtttcttacccaagaccgcaccctagccagg
aaattgaaggaggtgcgattggctcaaaaaattgagactgccttacccaaagatcaaatt
ttggaacgctatctaaacttgatctatctgggctctggggcctacggggtagcagatgcg
gcccatgcctatttcagcaagactccggaagagttgaccctaggggaggcggccacttta
gcgggagtagtaccagcccccagtgtttattccccccgacaaaatttggagctagctacc
cgtcgccgtaatgaagtgttgaaccgcatggcagaagtgggttttattacccccgcagag
gcccaggcggcgatcgccgaacccttagtaatcaaccccagtcccctgaagcgctttaac
cgggaggcggaattttttgctgactatattttggatgagttgcgggccaaattaccggaa
gaagaactgcaacaggggggattaactgtgaacactaccctcaatcaacaatggcaagag
gaagcccaaactgttctcagcgatgcggtgaaaagatacggccgttggcagcggttttct
gaaggggccatggtggccatggatccccgcaccggggccatcaaaatgatggtgggtggc
aaagactacgatgccagtcagtttaaccgagtgacccaagccaaacgacaaccaggatca
acttttaaacccattctgtacggagcggcgatcgcctccggcatttcccccaacaaaagt
taccttaatgtgcccattgacattggcggctaccaaccggccaactatggcgatcgctat
actggcggcaacatgtccctgacggatgctctcaccagttctgtcaatgtggtggcggtg
cgcttactgctggatgtgggctggaatccagtcatcaatttggcccgacaaatggggatt
acttccaagctggaacctacctattccctcgctttaggcgcttgggaaatgaccccgttg
gaaatgaccagtgcctacggtacctttgccaataagggtacccatgtgcaaccctacgcc
atccaaaatgtggtcaacgctcaaggggaagtggtgtacaaggcagaacataaacaaacc
caagccctagatcccgaaagcaatgccatcctcacttccatgatgcgtcgggtcgtcact
tccggtactggtcgccccgctcaattaggcgatcgccaagtagcaggaaaaaccggtaca
tcggatgaagcaaaggatctttggtttattggttatattccccaactggtcaccggggtg
tggttaggcaacgacaatagtcgccccaccaatggagccagcaccaccgccgccatggtt
tggggacaatttatgcgggacgccaccaaggggatgccggtgcaatccttccctgccctg
cccaaaaatctcgaccaacgtaaacccagcattaaagccgaacccattaagcgtcgggtc
aaaacccttgctcctcctagctcaccggaaacagacggtcagaacaccactgagcgaccc
cgccgtcatcgccgtacccagaccgatgccgcccgccccagtaatatccaaactgctagg
actagtgctccagcttctgcaccctcagctccccctagggcagtcagtgctccggcccca
gttgctgctcctgcagccgcccccgccgatgctaatgccggattacccgctccccctgct
gcccgtaaatctgagtaa

DBGET integrated database retrieval system