KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2262Help
Entry
SYNGTS_2262       CDS       T02098                                 

Gene name
sll0200
Definition
(GenBank) transposase
  KO
K07494  putative transposase
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_IS630 HTH_28 HTH_17 HTH_23 HTH_29 HTH_33 HTH_7 MerR_1
Motif
Other DBs
NCBI-ProteinID: BAK51010
Position
complement(2523877..2524236)
Genome map
AA seq 119 aa AA seqDB search
MAYSLDLRQRVVAYIEAGGKITEASKIYKIGKASIYRWLNRVDLSPTKVERRHRKLDWEA
LKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKNYVIEKETGRNELSTIEC
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggcttacagtttagatttaaggcaaagggtagtagcttatatagaagctggaggaaaa
ataactgaggcttccaagatatataaaataggaaaagcctcgatatacagatggttaaat
agagtagatttaagcccaacaaaagtagagcgtcgccataggaaattagactgggaagct
ctaaaaaaagacgtagaagaaaatcccgatgcaagattgatagacagagccaagaaattt
ggagtgaggccgagtgccgtatattacgcattaaagaaaatgaaaataaacagaaaaaaa
aagaactacgttatcgagaaagaaaccgggaggaacgagttaagtactatagaatgttaa

DBGET integrated database retrieval system