KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2273Help
Entry
SYNGTS_2273       CDS       T02098                                 

Gene name
slr0232
Definition
(GenBank) hypothetical protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc ECR1_N UPF0093
Motif
Other DBs
NCBI-ProteinID: BAK51021
Position
2535640..2536296
Genome map
AA seq 218 aa AA seqDB search
MGWEFFSLETLQELARQYGYGAVFFGIALENAGIPIPGETITLLGGFLAGSGDLSYGGVL
IAAIAGAVLGDSCGYWVGRWGGWPLLTRAAQLFNIPQEKLDQARHKFSQNGAAAVFFGRF
VTLLRIFAGPMAGIVRMPYGKFLLYNIGGASVWAAITVSLAYFLGRVVTIEQIIAWTTQF
SWFALAAVVGMVGIYFVFHFLQKRFDQTIESTIGDRPQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgggttgggaatttttttcgctagagacattgcaggaattggcccgccaatatggttac
ggagccgtattctttggcattgccttggaaaatgcaggcattcccatccctggagaaacc
ataaccctgttggggggctttttggccggcagtggagatttaagttatggcggggtatta
atcgcggcgatcgccggggccgtgttgggggacagttgtggttactgggtgggacgctgg
ggcggttggcccttactaaccagggcggcccaactgttcaacattccccaggaaaaacta
gaccaagcccggcataaatttagtcagaatggggcggccgcagtgttttttggtcgtttt
gttaccctgttacgaatttttgcggggcccatggccggcattgtccgcatgccctacggc
aaattcctgttgtacaacatcggcggtgcctccgtctgggctgccatcaccgttagtttg
gcttactttttggggcgggtggtcaccatcgagcaaattattgcctggacgacccaattc
agttggtttgccctagcagcagtggtgggcatggtgggcatttactttgtctttcacttc
ctgcaaaagcgttttgatcaaaccattgagtcgaccataggcgatcgcccccaataa

DBGET integrated database retrieval system