KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2274Help
Entry
SYNGTS_2274       CDS       T02098                                 

Gene name
trxM
Definition
(GenBank) thioredoxin M
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_8 AhpC-TSA Thioredoxin_7 TraF Thioredoxin_9 OST3_OST6 HyaE KaiB Thioredoxin_6 Redoxin DIM1 Thioredox_DsbH DUF836 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: BAK51022
Position
2536337..2536654
Genome map
AA seq 105 aa AA seqDB search
MAVKKQFANFAEMLAGSPKPVLVDFYATWCGPCQMMAPILEQVGSHLRQQIQVVKIDTDK
YPAIATQYQIQSLPTLVLFKQGQPVHRMEGVQQAAQLIQQLQVFV
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaaaaaacagtttgctaattttgctgaaatgctggccggttcccccaagccg
gtgctagtggacttttacgctacctggtgcggcccctgccaaatgatggcccccattctg
gagcaagtgggcagtcatctacgccaacaaatccaagtggtgaaaattgacactgataaa
tatccggcgatcgccacccaataccaaatccagtctttaccgaccttggtgttattcaag
cagggccaaccagtgcaccgcatggaaggcgtacaacaggccgcccagttgatccaacag
ttacaggtttttgtgtaa

DBGET integrated database retrieval system