KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2277Help
Entry
SYNGTS_2277       CDS       T02098                                 

Gene name
sll0415
Definition
(GenBank) ABC transporter
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Module
syy_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:syy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syy02000]
    SYNGTS_2277 (sll0415)
Transporters [BR:syy02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    SYNGTS_2277 (sll0415)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 T2SSE AAA_23 RsgA_GTPase AAA_29 AAA_30 MobB
Motif
Other DBs
NCBI-ProteinID: BAK51025
Position
complement(2539637..2540701)
Genome map
AA seq 354 aa AA seqDB search
MRFRCYLIFSIFSDSLLGAGFFQGGKRAMVVSTPIAAEEKPPIQANVVETWEISKIYRTG
FWMNQKVESLKPLSIAVQQGETFGLLGPNGAGKTTLLKILLGVIRASGGRGTLLGKPIGD
RQTKQRVGYLPENAYFYDFLTAWEFLDYIGSLFQIGKQERQRRILAMCDLVGLAQKTAKK
KQLRQYSKGMLQRVGMAQALINDPEVVFLDEPMSGLDPLGRYQVREIILSLKEQGKTIFF
NSHILADVEQICDRIAILARGELLCSGSLAEVLGNDEGYEVVLKGGEEEALGKYLANLSQ
EQDVWHGHYQGDVQALVDALPSLNARLISMNLARPSLEDYFIRQLRERGITTSQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttcgatgttacttaatatttagtatatttagtgactcgctcttgggagcagga
ttttttcagggaggaaaaagagcaatggttgtgtcaactccgatcgccgctgaggaaaag
ccaccgattcaggccaatgtggtggaaacttgggaaattagcaaaatctaccgcaccggc
ttttggatgaatcagaaggtggagtcccttaaacctttgtccattgccgtacagcaaggg
gaaacctttggtttactgggtcctaatggagcaggtaaaactaccctgttaaaaattctt
ttgggggtaattcgtgccagcggtggccggggtactctactaggcaaacccatcggcgat
cgccagactaaacaacgggtgggctacctaccggaaaatgcctacttttatgacttttta
accgcttgggaatttttggattacatcggcagtctgtttcaaattgggaaacaggaacga
caacggcgcattctggccatgtgtgacctggtggggttagcccaaaaaaccgccaaaaag
aagcaattgcgacaatattccaaaggtatgttgcaacgggtgggcatggcccaggcattg
attaacgatcctgaagtcgttttcctcgatgaacccatgtccggtttggaccccctgggg
cgctaccaagtgcgggaaattattctttccctcaaggaacagggcaaaaccatctttttc
aactcccacattttggcggacgtggaacaaatttgtgaccgcattgccattttggcgcgg
ggggaattgctgtgcagtggttctttggcggaagtgttaggtaatgacgaaggctatgaa
gtggtgctcaagggaggagaagaagaggcgttgggtaaatatctagccaatttaagtcag
gaacaggatgtttggcacggccattaccaaggggatgtccaagctctagtggatgcgtta
cccagtcttaatgcccgtttgatcagcatgaacctggcccgcccttccctggaagattat
ttcatccgccaactgcgagaacggggtatcaccaccagccagtga

DBGET integrated database retrieval system