KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2287Help
Entry
SYNGTS_2287       CDS       T02098                                 

Gene name
efp
Definition
(GenBank) elongation factor P
  KO
K02356  elongation factor P
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
KEGG Orthology (KO) [BR:syy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:syy03012]
    SYNGTS_2287 (efp)
Translation factors [BR:syy03012]
 Prokaryotic Type
  Elongation factors
   SYNGTS_2287 (efp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Elong-fact-P_C EFP_N EFP
Motif
Other DBs
NCBI-ProteinID: BAK51035
Position
2548205..2548768
Genome map
AA seq 187 aa AA seqDB search
MISSNDFRTGTSIVMDGAVWKVVEFLHVKPGKGSAFVRTKLKSVQTGNVVEKTFRAGETV
PQANIEKSVMQHTYKDGDQYVFMDMETFEEVSIAPDTLGDKAKFIKEEMEVSVVTWDGTI
LDVELPTSVVLEIVETDPGVKGDTATGGTKPAILETGAQVMVPLFIAQGERIKVDTRDGS
YLGRDNA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgatatccagtaacgattttcgcacaggtaccagtattgtgatggacggcgcagtctgg
aaggtggtggaattcctccacgttaaaccaggcaagggttccgcctttgtgcggaccaag
ctcaaaagtgttcaaaccggcaacgtggtggaaaaaactttccgggcgggggaaacggtg
ccccaggccaacatcgaaaaatcagtgatgcaacatacctataaagatggggaccaatat
gtctttatggatatggaaacctttgaagaggtgagcattgcccccgataccctgggagac
aaggccaaattcatcaaagaggagatggaagtcagcgttgtcacttgggatggcaccatt
ctggatgtggaattgcctaccagcgttgtgctggaaattgttgaaactgaccccggtgtg
aagggagatacggccactggcggcaccaagccagccattttggaaaccggtgcccaggta
atggtgcccctattcattgcccagggagaaaggattaaagttgataccagggatggttcc
tacctaggacgggacaatgcctaa

DBGET integrated database retrieval system