KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2288Help
Entry
SYNGTS_2288       CDS       T02098                                 

Gene name
accB
Definition
(GenBank) biotin carboxyl carrier protein of acetyl-CoA carboxylase
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00061  Fatty acid biosynthesis
syy00620  Pyruvate metabolism
syy00640  Propanoate metabolism
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
syy01120  Microbial metabolism in diverse environments
syy01130  Biosynthesis of antibiotics
syy01200  Carbon metabolism
syy01212  Fatty acid metabolism
Module
syy_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SYNGTS_2288 (accB)
   00640 Propanoate metabolism
    SYNGTS_2288 (accB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SYNGTS_2288 (accB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 HlyD_3 DUF2890
Motif
Other DBs
NCBI-ProteinID: BAK51036
Position
2548876..2549340
Genome map
AA seq 154 aa AA seqDB search
MAINFTELRELLGVISQSNITEFSLKSGDFEVSVRKDGMAGGISVVPQAIAPQPAPVVSA
SVPSPEVAAPSPADQKWTAIVSPMVGTFYRAPAPDEPPFVEVGDAVSKGQGVCIIEAMKL
MNEIEAEVAGQVMEIVVENGEPVEYGQTLMWIKP
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtggctattaactttacggaactgcgggaattgttgggggtaatttcccaaagtaatatc
acggagttcagtctaaaaagcggcgattttgaggtgtcagtccgtaaggatggtatggcc
ggcggcatctccgttgtccctcaggcgatcgccccccagcctgccccggtggtttctgcc
tcagttccctcccccgaagttgcggccccatccccagcggatcaaaagtggacggcgatc
gtttcccccatggtgggtactttttaccgagccccagccccggatgagcctccctttgtg
gaagtgggagatgcagtcagcaaaggccagggagtgtgcatcattgaagcaatgaagtta
atgaatgaaattgaagcggaagtggcggggcaagtgatggagattgtggtggaaaatggg
gagccggtggaatacggtcaaaccctaatgtggattaaaccctag

DBGET integrated database retrieval system