KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2292Help
Entry
SYNGTS_2292       CDS       T02098                                 

Gene name
glcD
Definition
(GenBank) glycolate oxidase subunit GlcD
  KO
K00104  glycolate oxidase [EC:1.1.3.15]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00630  Glyoxylate and dicarboxylate metabolism
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
syy01120  Microbial metabolism in diverse environments
syy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SYNGTS_2292 (glcD)
Enzymes [BR:syy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     SYNGTS_2292 (glcD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: BAK51040
Position
complement(2552778..2554256)
Genome map
AA seq 492 aa AA seqDB search
MAIFSPVNAVTDIIPQLEKIVGQDGVIKRKDELFTYECDGLTGYRQRPALVVLPRTTEQV
ATIVKLCHDRQIPWIARGAGTGLSGGALPGADSLLIVTTRMRQILAVDYDNQTIVVQPGV
VNNWVTQTVSGAGFYYAPDPSSQIVCSIGGNIAENSGGVHCLKYGTTTNHVLGLKLVIPD
GSIVEVGGQVPETPGYDLTGLFVGSEGTLGIATEITLKILKTPESICVVLADFLSLEATA
QSVADIIAAGIVPAGMEIMDNFSINAVEDVVATNCYPRDAAAILLVELDGLPIEVELNQA
KVEEICRNNGARNTAIAYDQETRLKMWKGRKAAFAAAGKLSPSYFVQDGVVPRTQLVQIL
SDINDLSKKYGFAIANVFHAGDGNLHPLILYDQKVPGAWEKVEELGGEILKRCVELGGSL
SGEHGIGIDKNCFMPNMFNEVDLETMQWVRQCFNPDNLANPGKLFPTPRSCGEVANAQRL
NLGQDKKMEEIY
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggccattttctcccccgtcaacgccgttaccgatattattccccagctcgaaaaaatt
gttggccaggatggagtaattaaacgcaaagacgagctattcacctacgaatgcgacggt
ttaacgggttatcgacaacggccggccctggtggttttgccccgcacaacggaacaggta
gccacaatagtgaaactttgtcacgatcgccaaattccttggattgccaggggggctggc
acagggttatcggggggagccttgccgggggccgatagcctattgattgtcaccactcgc
atgcggcaaattttggcagtagattacgacaaccagaccattgttgtccagccgggggtg
gtgaataactgggttacccaaaccgttagtggggctggcttttactatgcccctgatcct
tccagtcagattgtctgctccattggcggtaatattgcggaaaattccggtggagttcat
tgtttgaaatatggcaccaccaccaaccatgtgctgggcttgaaactggttattcccgat
ggctccattgtggaagtaggggggcaagtccccgaaacgccgggctacgatttaaccggt
ttatttgttggttccgaaggaaccctaggcatcgccacagaaatcaccctaaaaattctc
aaaaccccagaatctatctgtgtcgtattggcggattttctttctctcgaagccaccgcc
caatccgtggccgatatcattgcggcgggcatcgtcccagcgggcatggaaattatggac
aatttcagcatcaatgcggtggaagacgtggtggccaccaattgttaccccagggatgcg
gcggccattttgttagtggaactggacggtctgcccatcgaagtggaattaaaccaagcc
aaagtagaagaaatttgccgcaacaatggagcccgcaacacggcgatcgcctacgaccaa
gaaacccgcctaaaaatgtggaaaggaagaaaagcggcctttgcggcggcgggtaaacta
agccccagttactttgtccaagatggtgtggtaccccggactcaattggtacagatttta
agcgacattaatgatttaagtaagaaatatggctttgccattgccaatgttttccatgcc
ggagacggtaatttacatcccctaattttgtatgatcaaaaagtaccaggagcctgggaa
aaagtggaagaattggggggagaaatccttaaacgctgtgtggaattggggggaagttta
tccggagaacacggcattggcattgataaaaattgctttatgcccaatatgttcaacgaa
gtagatttagaaacaatgcaatgggtcagacaatgttttaatcctgataacttagctaat
cctggtaagctttttcctaccccccgcagttgtggagaagtggccaatgcccaacggctt
aacctaggccaggacaagaaaatggaggaaatttattga

DBGET integrated database retrieval system