KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2312Help
Entry
SYNGTS_2312       CDS       T02098                                 

Gene name
ilvN
Definition
(GenBank) acetolactate synthase
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00290  Valine, leucine and isoleucine biosynthesis
syy00650  Butanoate metabolism
syy00660  C5-Branched dibasic acid metabolism
syy00770  Pantothenate and CoA biosynthesis
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
syy01130  Biosynthesis of antibiotics
syy01210  2-Oxocarboxylic acid metabolism
syy01230  Biosynthesis of amino acids
Module
syy_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
syy_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:syy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SYNGTS_2312 (ilvN)
   00660 C5-Branched dibasic acid metabolism
    SYNGTS_2312 (ilvN)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SYNGTS_2312 (ilvN)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SYNGTS_2312 (ilvN)
Enzymes [BR:syy01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SYNGTS_2312 (ilvN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 ACT_6 DUF150_C
Motif
Other DBs
NCBI-ProteinID: BAK51060
Position
complement(2574161..2574679)
Genome map
AA seq 172 aa AA seqDB search
MKHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQGDVSRITMVVPGDENTIEQL
TKQLYKLVNVIKVQDITETPCVERELMLVKVSANAPNRAEVIELAQVFRARIVDISEDTV
TIEVVGDPGKMVAILQMLAKFGIKEVARTGKIALVRESGVNTEYLKSLESKF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacaccctctctgttttagttgaagatgaagccggagtgctaacccgcattgcc
ggactatttgcccgccgtggttttaacattgagagcttggcggtggggtcggcggaacag
ggggacgtttcccgcatcaccatggtggtgccgggggatgagaacaccatcgaacaactg
accaagcaactctacaagttggttaacgtaattaaagtacaggacatcaccgaaactccc
tgtgtggaaagggaattgatgctggtgaaggtgagcgccaatgcccctaaccgagcggaa
gtgattgagctagcccaggtattccgggcccgcattgtggatatctccgaagacaccgtc
accatcgaagtggtgggggacccgggtaaaatggtagcaatcctccagatgttggccaag
ttcggcattaaagaggtggctcgaacgggcaaaattgctttggtgcgggaatccggcgtc
aatacggaatatctgaaatccctggaatccaagttttag

DBGET integrated database retrieval system