KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2324Help
Entry
SYNGTS_2324       CDS       T02098                                 

Gene name
slr0060
Definition
(GenBank) hypothetical protein
  KO
K07001  NTE family protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
KEGG Orthology (KO) [BR:syy00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    SYNGTS_2324 (slr0060)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Patatin
Motif
Other DBs
NCBI-ProteinID: BAK51072
Position
2582227..2583336
Genome map
AA seq 369 aa AA seqDB search
MKPKVAIACQGGGSQTAFTAGVMKALFENKMQDHFDIVSLSGTSGGAICALLIWYALKKG
ENPVWKRLLDFWLDNSAQTYQERFFNDFVIRSLELTSKGIVPQYSVTPYSPLAQTWLASA
TQGLRSRFINLEELLQVHVDFSELATWGKQLEPPVLLIGACNILTGKLDKFNSRQEAIRI
EHLLASACVPNIFPTVVIEEEGEKKAYWDGLFSDNPPIRSLYRQDFVGIENIPQEIWVIK
INPTQTDKIPTDADDIADRRNELEGNVSLFQSLDQIEFLNYLFIKGAFKEEFLQEVGIKE
PLKIPKSFPEDPDQTYHIPAIEMSPELAKSLNYENKLDRCPENINRLIADGEKQGKKFIQ
TRLQQMGIH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccaaagtggcgatcgcctgtcagggtgggggcagccaaactgctttcaccgcc
ggtgtaatgaaggctctgttcgagaacaagatgcaagaccacttcgacattgtgagtttg
agtggtacttctggaggcgctatttgtgccctactaatttggtatgccctgaaaaaagga
gaaaatccggtctggaaaagattgcttgatttttggctggataacagtgcccaaacctat
caggaaagattttttaatgattttgtcattaggtctctggagttgaccagcaaaggcatc
gttccccagtatagtgtgactccctattctcccctagcccagacctggttagcttcggct
acccaagggttacggagtcgctttatcaatttagaagaattgttacaggttcatgtcgat
ttttcagagttagcaacttggggcaagcaattagagcccccggtacttttaattggagct
tgcaatattctgacgggaaaactagataagtttaattctcgccaggaagccataagaata
gagcatctgcttgcttcggcctgtgtgccaaatatttttcccaccgttgttattgaagaa
gagggtgaaaaaaaagcttactgggatggcttattttctgataatcctcccattcgttct
ttatacaggcaagattttgtcggtattgagaacattccccaggaaatttgggtaattaaa
attaatccgacccagaccgataaaattcccaccgatgccgatgacattgccgatcgccgc
aatgagttggaagggaatgtttctttatttcaaagcctggatcaaatcgaatttctcaat
tatttatttataaaaggagcttttaaagaggagtttttacaggaagttggcatcaaagag
ccgttaaaaatacctaagtcttttcctgaagatcccgaccaaacttatcatataccagcc
attgaaatgtcaccggaattggctaaaagtttaaattatgaaaataaattagatcgttgc
ccagaaaacattaatcggctgattgccgacggagaaaaacagggaaagaaatttatccaa
acgagactccaacaaatgggtattcattga

DBGET integrated database retrieval system