KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2328Help
Entry
SYNGTS_2328       CDS       T02098                                 

Gene name
grpE
Definition
(GenBank) heat shock protein GrpE
  KO
K03687  molecular chaperone GrpE
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
KEGG Orthology (KO) [BR:syy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:syy03110]
    SYNGTS_2328 (grpE)
   03029 Mitochondrial biogenesis [BR:syy03029]
    SYNGTS_2328 (grpE)
Chaperones and folding catalysts [BR:syy03110]
 Heat shock proteins
  HSP24
   SYNGTS_2328 (grpE)
Mitochondrial biogenesis [BR:syy03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    SYNGTS_2328 (grpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GrpE Arfaptin Bap31 DivIC
Motif
Other DBs
NCBI-ProteinID: BAK51076
Position
complement(2587701..2588450)
Genome map
AA seq 249 aa AA seqDB search
MNEDQVSLENQTNPVSPEASDVPAVTPEESPQPTDAVLGEPSGEQSEDPRIGAATETEGG
PLEQEKSSEEIIAILQKDLASHRQELAEQSEQLDSIKKRYVALAAEFDNFRKRTQREKEE
QAKLIKGRTITELLPVVDNFERARTQIKPNSDGENQIHKSYQGVYKNLVDSLKGLGVAPM
RPEGKPFDPKYHEAMLREPTAEYPEDTVIEELVRGYLLDDIVLRHSMVKVAVAPEEGAEV
VNGEAGANP
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagatcaagtttccctcgaaaatcaaaccaatcctgtctccccagaggccagt
gatgttcctgccgtaactccggaggaaagtccccagcccactgatgctgttttaggagag
ccgtccggggaacagtcggaagatccgaggattggcgctgccacagaaacggaagggggg
ccgctggaacaagaaaaaagcagtgaagagataattgccattctgcaaaaagacctggcc
agccatcgccaggaattggctgaacagtcggagcaactagactccatcaaaaagcgttac
gtggccctggcagctgaatttgataattttcgcaagcgcacccagcgggagaaagaggag
caagcaaaactcatcaaaggaaggaccataacagaacttttgccggtggtggacaatttt
gagcgggcccgcacccagatcaagcccaactccgacggggaaaatcagatccacaaaagt
tatcagggggtgtacaaaaacctggtggacagccttaaaggtttgggggtagctcccatg
cgccctgagggaaaaccttttgatcctaaataccatgaggcgatgctccgggaacccacc
gctgaatatcccgaggatacggtgattgaggagttggtgcggggttatcttttagatgac
attgtgctgcgtcattccatggtcaaggtggcggtggctccggaagaaggagctgaagtg
gtgaatggagaggcgggagctaacccctag

DBGET integrated database retrieval system